KEGG   Mycobacterium marseillense: CKJ54_05875Help
Entry
CKJ54_05875       CDS       T05049                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00790  Folate biosynthesis
mmal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKJ54_05875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmal04147]
    CKJ54_05875
Enzymes [BR:mmal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CKJ54_05875
Exosome [BR:mmal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKJ54_05875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ASW89472
UniProt: A0A1A3JAJ7
Position
complement(1170195..1170479)
Genome map
AA seq 94 aa AA seqDB search
MAVLTDEQVDAALPDLDGWERADGALRRSIKFGSFLAGIDAVRRVAEHAESKDHHPDIDI
RWRTVTFALVTHSEGGITQNDVDMARDINGIVDN
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgttaacggatgaacaggtagacgccgcactgcccgatctggacggatgggaa
cgtgccgacggcgctctgcgccgctcgatcaaattcggaagcttcctggccggcatcgac
gcggtgcgccgcgtggccgagcacgcggaaagcaaggatcaccacccggacatcgatatt
cggtggcggacagtgactttcgctctcgtcacccactccgagggcggcatcacccaaaac
gacgtcgatatggcccgcgacatcaacgggatcgtcgacaactag

DBGET integrated database retrieval system