KEGG   Mycobacterium marseillense: CKJ54_10130Help
Entry
CKJ54_10130       CDS       T05049                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00061  Fatty acid biosynthesis
mmal00071  Fatty acid degradation
mmal01100  Metabolic pathways
mmal01212  Fatty acid metabolism
mmal02024  Quorum sensing
Module
mmal_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CKJ54_10130
   00071 Fatty acid degradation
    CKJ54_10130
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CKJ54_10130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmal01004]
    CKJ54_10130
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmal04147]
    CKJ54_10130
Enzymes [BR:mmal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CKJ54_10130
Lipid biosynthesis proteins [BR:mmal01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CKJ54_10130
Exosome [BR:mmal04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CKJ54_10130
  Exosomal proteins of breast cancer cells
   CKJ54_10130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding TPT
Motif
Other DBs
NCBI-ProteinID: ASW90186
Position
complement(2136146..2137948)
Genome map
AA seq 600 aa AA seqDB search
MREYSVPARFPVDDDDNIAAMVFEHERDDPNFVIYQRQVDGEWTDVTCAEAAGQIRSAAL
GLIALGVQAGDRVSIFCATCYEWAILDLAILSIGAVTVPIYETSSAEQVRWVLQDSEAVL
AFAETDEHAAMVTELTAELPALRRVLHIDGSGPKALDQLVEAGESVEPAELTARLEALRA
GDPATLIYTSGTTGRPKGCQLTHSNLLYETRGAKESLPTLLDEGQRLLIFLPLAHVLARS
LTLSAFANKVTVGFTSDIKNLVPMFAVFKPTVVVSVPRVFEKVYNTAEQNAANDGKGRIF
AMAVQTAVDWSEASDRGRRGPLLRAKHALFDRLVYRKLRGALGGECHASVSGGAPLGSRL
GHFYRGVGLTIHEGYGLTETSSAITVNQVGNVKIGTVGTLLPGNSMRIADDGELLVRGGV
VFSGYWRNEQATADAFTDGWFRTGDLGVLDEDGFLKITGRKKEIIVTAGGKNVAPAVLED
RLRAHPLISQAMVVGDNKPFIAALITIDPEAFDGWKQRNQKGSGTSVADLATDPDLVAEV
DAAIKDANLAVSHAESIRKFRILPVDFTEDTGELTPTMKVKRNVVAEKFAFDIEAIYQKD
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagtacagcgtccccgcccgctttccggtcgacgatgacgacaacatcgccgcg
atggtcttcgaacacgagcgcgacgacccgaactttgtcatctaccagcgtcaggtcgac
ggcgagtggaccgacgtcacctgcgccgaggcggccggccagatccgctccgccgcactg
ggtttgatcgcactcggggtacaggccggcgaccgggtgtcgatcttctgtgccacctgc
tacgaatgggcgatcctcgacctggcgatcttgtcgatcggcgcggtcaccgtgccgatc
tacgagacgtcgtcggccgaacaggtgcgctgggtgctgcaggactccgaggcggtgctg
gccttcgccgaaaccgacgaacacgcggccatggtcaccgaactgaccgccgaactgccc
gccctgcgccgggtgctgcacatcgacggttcgggccccaaggcgctcgaccaactcgtc
gaggccggcgagtcggtggagccggccgagctgaccgcacgcctggaggccctgcgggcc
ggggaccccgcgacattgatctatacctcgggcaccaccgggcggcccaagggctgccag
ctgacacattcgaacctgctgtatgagacccgcggcgccaaggagagcctgccgacgctg
ctcgacgagggccagcggctgctgatcttcttgccgctggcgcacgtgctggcgcgctcg
ctgacgttgtccgccttcgccaacaaggtgacggtcgggttcaccagcgacatcaagaac
ctggtgccgatgttcgcggtgttcaaaccgaccgtggtggtgtcggtcccgcgggtgttc
gaaaaggtctacaacacggccgagcaaaacgcggcgaacgacggcaagggccggatcttc
gccatggccgtgcaaaccgccgtcgactggagcgaggcctccgaccgcggccggcggggg
ccgctgctgcgcgccaagcacgcgctgttcgaccggctggtctaccgcaagttgcgcggg
gcgctgggcggcgagtgccatgcgtccgtgtcgggcggcgcgccgctggggtcgcggctg
gggcacttctaccggggcgtcggcctgaccatccatgagggctacggcctgaccgagacc
agctccgcgatcacggtcaaccaggtcggcaacgtcaagatcggcacggtcggaacgttg
ttgcccggcaacagcatgcgcatcgccgacgacggcgagctgctggtgcgcggcggcgtg
gtgttcagcggctactggcgcaacgagcaggccaccgccgacgcgttcaccgacgggtgg
ttcaggaccggcgatctgggcgtgctcgacgaggacggcttcttgaagatcaccggacgc
aagaaggagatcatcgtcaccgcgggcggcaagaacgtcgcgcccgccgtgctcgaggac
cggctgcgggcgcatccgctgatcagtcaggccatggtcgtcggcgacaacaagccgttc
atcgccgcgctgatcaccatcgaccccgaggcgttcgacggctggaaacagcgcaaccag
aagggatccggcacctcggtggccgacctggccaccgatcccgacctcgtcgccgaggtg
gacgcggccatcaaggacgccaatctggcggtgtcgcacgccgagtcgatccgcaagttc
cgcatcctgccggtcgatttcaccgaggacaccggcgagctgaccccgacgatgaaggtc
aagcgcaacgtggtggcggaaaaattcgccttcgacatcgaggccatctaccaaaaggac
tga

DBGET integrated database retrieval system