KEGG   Mycobacterium marseillense: CKJ54_19975Help
Entry
CKJ54_19975       CDS       T05049                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00020  Citrate cycle (TCA cycle)
mmal00480  Glutathione metabolism
mmal01100  Metabolic pathways
mmal01110  Biosynthesis of secondary metabolites
mmal01120  Microbial metabolism in diverse environments
mmal01130  Biosynthesis of antibiotics
mmal01200  Carbon metabolism
mmal01210  2-Oxocarboxylic acid metabolism
mmal01230  Biosynthesis of amino acids
Module
mmal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKJ54_19975
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CKJ54_19975
Enzymes [BR:mmal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CKJ54_19975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH TCL1_MTCP1 MRP-L27
Motif
Other DBs
NCBI-ProteinID: ASW91895
UniProt: A0A1A3JQ59
Position
complement(4288740..4290977)
Genome map
AA seq 745 aa AA seqDB search
MSAEKPTVIYTLTDEAPLLATYAFLPIVRAFAEPAGIEIKTSDISVAARILAEFPEHLTE
EQRVPDNLAELGRLTKLADTNIIKLPNISASVPQLIAAVKELQGKGFKVPDFPQSPKTDE
DKEIRARYAKCLGSAVNPVLRQGNSDRRAPKAVKEYARKHPHSMAPWSPASRTHVATMKG
GDFYHGEKSMTLDRARNVKMELETESGETIVLKPMVSLRNADVIDSMFMSKKALVEFYEE
QMQDAYETGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHQELFDELGVDVNNGLV
DLYSKIESLPASLHEEIIRDLHACHEHRPELAMVDSAKGITNFHSPSDVIVDASMPAMIR
AGGKMWGADGRQKDTKAVNPESTFSRIYQEIINFCKTHGQFDPTTMGTVPNVGLMAQQAE
EYGSHDKTFEIPEGGVANIVDLDTGEVLLTQNVEAGDIWRMPIVRDEAIRDWVKLAVTRA
RNSGMTVVFWLDTERPHEVELRKKVKEYLKEHDTEGLDINIMPQVWAMRYTLERAMRGQD
TIAATGNILRDYLTDLFPILELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVHQLVEEN
HLRWDSLGEFLALGACFEDVGIKNDNERAKLLGKTLDSAIGKLLDNNKSPSRKTGELDNR
GSQYYLALYWAAELAAQNDDEELRDRFAALAESLAENEDTIVAELAEVQGESVDIGGYYY
PDSEKTTAVMRPSKTFNEVLAAAQG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgagaagccgaccgtcatctacacgctgaccgacgaggcgccactgctggcg
acctatgcgttcctgccgatcgtgcgtgccttcgccgaacccgcgggcatcgagatcaag
accagcgacatctcggtggcggcccggatcctcgccgaattccccgaacacctcaccgag
gagcagcgggtccccgacaacctggcggagttgggccggctgacgaagctggccgacacc
aacatcatcaagctgccgaacatcagcgcctcggtgccgcagctgatcgccgctgtcaag
gagctgcagggcaaggggttcaaggttccggactttccgcagagcccgaagaccgacgag
gacaaggaaattcgcgcccgctatgccaagtgcctgggcagcgcggtgaacccggtactg
cggcaaggcaactcggaccgacgcgctccgaaggccgtcaaggaatacgcccgcaagcac
ccgcacagcatggctccctggtcgccggcgtcgcggacccacgtcgcgaccatgaagggc
ggcgacttctaccacggcgagaagtcgatgacgctggaccgcgcgcgcaacgtgaagatg
gagctcgagaccgaaagcggcgagacgatcgtgctcaagccgatggtgtcgctgcgcaac
gccgacgtcatcgactccatgttcatgagcaagaaggcgctcgtcgagttctacgaggag
cagatgcaggacgcctacgagaccggcgtgatgttctcgttgcacgtcaaggcgacgatg
atgaaggtctcccaccccatcgtgttcgggcacgccgtgaagatcttctacaaggaggcc
ttcgccaaacatcaggagctcttcgacgaactcggcgtcgacgtcaacaacggattggtc
gacctgtacagcaagatcgagtcgctcccggcgtcgctgcacgaggagatcatccgcgac
ctgcacgcgtgccacgagcaccggcccgagctggcgatggtcgattcggccaagggcatc
accaactttcactcgcccagcgacgtgatcgtcgacgcgtcgatgccggcgatgatccgc
gcgggcggcaagatgtggggcgccgacgggcggcagaaggacaccaaggccgtcaacccc
gagtccacgttctcgcggatctaccaagagatcatcaacttctgtaagacccatgggcaa
ttcgatccgacgacgatgggcaccgttcccaacgtcgggctgatggcacagcaggccgag
gagtacggctcgcacgacaagaccttcgagatccccgagggcggggtggccaacatcgtc
gacctcgacaccggggaagtcctgctgacccagaacgtggaggccggcgacatctggcgc
atgcctatcgtccgcgacgaagcgatccgtgactgggtcaagctggccgtcactcgggcg
cgcaactcgggcatgacggtcgtgttctggctggacaccgaacgcccgcacgaggtggag
ctgcgcaagaaggtcaaggagtacctcaaggaacacgacaccgagggcctggacatcaac
atcatgccgcaggtgtgggccatgcgatacacgctggagcgcgcgatgcgcggccaggac
accatcgccgccaccggaaacatcctgcgcgactacctcaccgacctgttcccgatcctg
gagctgggcaccagcgccaagatgctgtccatcgtgccgttgatggccggcggcggaatg
tacgagaccggtgcgggcggttcggcgcccaagcacgtccaccaactggtcgaggagaat
cacctgcgctgggattcgctcggtgaattcctcgccctgggagcgtgtttcgaggacgtc
ggtatcaagaacgacaacgagcgcgccaagctgctgggcaagacgctggattccgcgatc
ggaaagctgttggacaacaacaagagtccgtcgcgcaagaccggtgaactcgacaaccgt
ggcagccagtactacctggcactgtactgggcggccgaactcgccgcgcagaacgacgac
gaggagttgcgcgaccgtttcgccgcgctggccgagtcgttggccgagaacgaggacacc
atcgtggccgaactcgccgaagtgcagggtgagtcggtcgacatcggcgggtactactac
ccggacagcgagaagacgacggcagtgatgcggccgagcaagacgttcaacgaggtgtta
gcggccgcgcaaggctga

DBGET integrated database retrieval system