KEGG   Mycobacterium marseillense: CKJ54_21125Help
Entry
CKJ54_21125       CDS       T05049                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CKJ54_21125 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmal03400]
    CKJ54_21125 (recB)
Enzymes [BR:mmal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CKJ54_21125 (recB)
DNA repair and recombination proteins [BR:mmal03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CKJ54_21125 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C AAA_30 UvrD_C_2 PDDEXK_1
Motif
Other DBs
NCBI-ProteinID: ASW92099
Position
4515614..4518916
Genome map
AA seq 1100 aa AA seqDB search
MERFDLLGPLPAERSTTVLEASAGTGKTFALAGLVTRYLADGAASLEQMLLITFGRAASQ
ELRERVRCQIVDAVRAFADPSTVGDNQLVAYLLDGTDEQRAARQQRLRDALAGFDAATIA
TTHQFCQLVLRSLGVAGDTAASVTLLDSLDDLVTEIVDDLYLAHFGQERDDPALHYSEAL
RLAREVVNNPSTQLRPRDPDPDSRAAICLRFANDVLAELDTRKRRLGVLGYDDLLTRLAD
ALATDNSPARLRMHQRWPIVMVDEFQDTDPVQWQVIDRAFSGRSTVILIGDPKQAIYAFR
GGDIVTYLRAAETAGRRKTLDTNWRSDSALVARLQVVLRGAQLGDPAIVVNDVDAHHRGH
RLAGAPHNDPFRLRVVARTTLGRRGIQNLPIDELREHIGADLAADIRALLAAGATFDGKP
LQARDIAVIVERHRDAHACFSALCAAGVPAVYTGNTDVFTSEAAEDWLCLLEAFDQPHRP
GMVRAAAATMFFGETAQTLAAGGDALTDRIAKTLREWAGHARERGVAAIFEAAQLLGMRD
RVLGWQGGERHMTDLAHVTQLLQDVAHREHYSLPALRDWLRRQRDERSGAPERNRRLDSD
AAAVQIMTVFVSKGLQYPIVYLPFAFNRNTQDSDVVLFHDEDGARCLHVGGRDSPDFKTV
ERLGRKEDASDDSRLTYVALTRAQTQVVAWWSPAYYEPNGGLSRLLRGRRPGDPVVPDRC
EPAKVSDDDALARLREWEAAGGPVIEDAVVAPAPALPPAPVPRNLDSRHFHRAIDTTWRR
TSYSGLIRVAQAGGVSSEPDVAGIDDEVGDIPLASLVAGPDVPSPMADLPAGATFGSLVH
AVLETADPFAADLAAELEAHIREHSGWWPVDVAPAELAAAMVPMHDTPLGPLAGGLTLRH
IGLSDRLRELDFELPLAGGDRPAAGPEARLADLAPLLREHLPADDPLASYADRLSDRALG
DQSLRGYLTGSIDAVLRIPDGPGHRYVVVDYKTNRLGDPERPLTAADYDRPRMAEAMLHS
DYPLQALLYCAVLHRFLRWRVGDYDPARHLGGVLYLFVRGMCGADTPVLDGHPCGVFSWR
PPPALITDLSDLLDARGVPA
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtttcgacctgttgggcccgctgccggccgagcgctccacgaccgtgctggag
gccagcgcgggcaccggcaagacgttcgcgctggccggcctggtgacgcggtatctcgcc
gacggcgcggcgagtctggaacagatgttgctcatcacgttcggccgcgccgccagccag
gagctgcgcgagcgtgtccgctgccaaatcgtcgacgccgtacgcgctttcgccgacccg
tcgacggtcggcgacaaccagttggtggcctacctgctggacggcaccgacgagcagcgc
gcggcgcgccaacagcgcctgcgcgacgcgctggccggcttcgacgcggcgaccatcgcc
accacccaccagttctgccagctggtgctgcgttcactcggcgtggccggcgacacggcc
gcgagcgtaaccctgctcgacagcctcgacgacctggtgaccgagatcgtcgacgacctg
tacctggcgcacttcgggcaggaacgcgacgacccggcgctgcactactccgaggcgctg
cggctggcccgcgaggtggtcaacaacccgtcgacccagctacggccgcgcgacccggac
ccggattcgcgggccgccatctgcctgcggttcgccaatgacgttctggccgagctggat
acgcgcaaacgccggctgggcgtgctcggctacgacgacctgctgacccggctggccgac
gcgctggccaccgacaactcccccgcccggctgcgcatgcatcagcgctggccgatcgtc
atggtcgacgaattccaggacaccgacccggtgcaatggcaggtgatcgaccgcgcgttc
agcggacgctccacggtgatcctgatcggcgaccccaaacaggcgatctacgcgttccgc
gggggcgacatcgtgacctacctgcgggcggccgagacggcgggccggcgcaagacgctg
gacaccaactggcgcagcgattccgcgctggtggcgcggctgcaggtggtgctgcgcggc
gcccagctcggtgaccccgcgatcgtggtgaacgacgtcgacgcgcatcaccgcggccat
cggctcgccggcgcgccccacaacgacccgttccggctgcgcgtcgtggcgcgaaccacc
ctggggcgccgcggcattcagaacctgcccatcgacgagctgcgcgagcacatcggcgcc
gatctcgccgccgacatccgcgccctgctcgccgccggcgccaccttcgacggtaaaccg
ctgcaggcccgcgacatcgccgtcatcgtggaacggcaccgggacgcgcacgcttgcttt
tcggcgctgtgcgccgcgggcgttccggcggtctacaccggcaacaccgacgtgttcacc
tccgaggcagccgaggattggttgtgcctgctggaggccttcgaccaaccgcaccggccc
ggcatggtgcgcgccgccgcggcgacgatgttcttcggtgagaccgcccaaacgctggcg
gccggtggcgacgcgctgacggatcggatcgcgaaaacgctgcgcgagtgggccggtcac
gcccgcgaacgtggcgtcgccgccatcttcgaggccgcccagctgctcgggatgcgggac
cgcgtgctcggctggcagggcggcgagcgacacatgaccgacctggcgcacgtcactcag
ctgctgcaggacgtcgcgcaccgcgagcactacagcctgccggcgctgcgtgactggctg
cgccggcaacgcgacgagcgcagcggcgcgcccgaacgcaaccgccgcctcgacagcgac
gccgccgccgtccagatcatgaccgtgtttgtcagcaagggactgcaatacccgatcgtg
tacctgccgttcgccttcaaccgcaacacccaggacagcgacgtggtgctgttccacgac
gaggacggcgcgcgttgtctgcacgtcggcggcagggacagccccgacttcaaaaccgtt
gagcggctgggccgtaaagaggacgccagcgacgacagcaggctgacctacgtcgcgttg
accagggcgcagacccaggtggtggcgtggtggtcgccggcgtactacgagcccaacggc
ggcctgtcgcggctgctgcgcggtcgccggcccggcgatcccgtcgttccggaccgctgc
gagcccgcgaaggtctccgacgacgacgccctggcccggttgcgcgagtgggaggccgcc
ggcgggccggtcatcgaggacgcggtggtggcgcccgccccggcgctgccgcccgcgccg
gtgccccggaacctggacagccgccacttccaccgcgccatcgacaccacttggcggcgc
acctcctattcgggcctgatcagggtggcccaggccggcggcgtcagcagcgaacccgac
gtcgccgggatcgacgacgaggtcggcgacatcccgttggcctcactggtcgccgggccg
gacgtgccctcgccgatggcggaccttccggcgggcgcgaccttcggctccctggtccac
gccgtgctggagaccgccgacccgttcgccgcggatctggccgccgagctggaggcacac
atccgggagcattcggggtggtggccggtcgacgtcgcccccgcggagctggccgcggcc
atggtgccgatgcacgacacgccgctgggccccctggcgggcgggctgacgctgcgccac
atcgggctctcggatcggttgcgggaactggacttcgagcttccgctggccggcggtgat
cgcccggcggcgggaccggaagcccgcctggcggatctggcgccgctgctgcgcgagcac
ctgccggccgacgatccgctggcgtcgtatgccgaccggctgtcggaccgggcgctcggt
gatcaatcgttgcgcgggtacctcaccgggtcgatcgacgcggtgctgcgcattcccgac
ggtcccggacaccgctacgtcgtggtggactacaagaccaaccggctcggagatccggag
cggccgctgacggccgccgactacgaccgcccgcggatggcggaggcgatgctgcactcg
gactatccgctgcaggcgttgctgtactgcgcggtgctgcaccggttcttgcggtggcgg
gtaggcgattacgacccggcccgccacctcggcggcgtcctctacctgttcgtgcgcggc
atgtgcggcgcggacaccccggtgctcgacgggcacccgtgcggcgtcttcagttggcgc
ccgccgccagcgttgatcaccgacctgtcggacctgctcgacgcccgaggggtgccggca
tga

DBGET integrated database retrieval system