KEGG   Mycobacterium marseillense: CKJ54_23015Help
Entry
CKJ54_23015       CDS       T05049                                 

Definition
(GenBank) beta-glucosidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00520  Amino sugar and nucleotide sugar metabolism
mmal01100  Metabolic pathways
mmal01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CKJ54_23015
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CKJ54_23015
Enzymes [BR:mmal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CKJ54_23015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ASW92425
Position
complement(4900954..4902108)
Genome map
AA seq 384 aa AA seqDB search
MAFSRTFAVLVAASALVAGCAHHPAPPPAHSSTSSKPAAAPAPPVCADPTAVPAALGIRD
KLAQLLMVGVKNADDARAVVNGYHVGGIFIGSWTDLAIFQGSLADISAKAGPLPLAVSVD
EEGGRVSRLKTLIGTSPSARELAQTQTVQQVHDLAADRGRKMRELGITVDFAPVVDVSDE
DDDAVIGNRSFSADPQTVTEYAGAYAQGLRDAGLLPVLKHFPGHGHGSGDSHTGGVVTPP
LSDLQTSDLVPYRSLAAASPVAVMVGHLQVPGLTGDVPASLSPEAVQLLRNGVGYKGPPF
TGPVFSDDLSSMAAISDRYGVSEAVLRTLLAGVDIALWVTTDEVPAVLDRLQKAVASGEL
PAQRVDEALVRVAKMKGPGPACGH
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcgcgcaccttcgccgtgctcgtggccgcgtcggcgctggtggccggctgc
gcccaccaccccgcacccccacccgcccactcatcgacctcgagcaaaccggcggccgcg
ccggcgcccccggtgtgcgccgacccgaccgcagtgccggccgcgctgggcatccgcgac
aagctggcccagctgctgatggtgggcgtgaagaacgccgacgacgcccgggccgtcgtc
aacggctaccacgtcggcgggatcttcatcggcagctggaccgacctggcgatcttccag
gggtcgctggccgacatcagcgccaaggcgggaccgctgccgctggcggtcagcgtcgac
gaagagggtggccgggtgtcgcggttgaagaccctgatcggcacgtcgccctcggcccgg
gagctggcgcagacacagaccgtccagcaggtccacgatctggcggccgaccgcggccgc
aagatgcgcgagctgggcatcaccgtcgacttcgcccccgtggtcgacgtcagcgacgag
gacgacgacgccgtcatcggcaaccgttcgttcagcgcggacccgcagacggtgaccgag
tacgccggggcctacgcgcagggcctccgcgacgccggactgctgccggtgctcaagcat
ttccccggccacgggcacggctcgggcgattcgcacaccggcggtgtggtcacgccgccg
ctgagcgacctgcaaaccagtgacctggtgccctaccggtcgctggcggccgcgtcgccg
gtcgcggtgatggtgggccacctgcaggtcccggggctcaccggcgacgtccccgccagc
ctgagcccagaggcggtgcagttgctgcgcaacggtgtcggctacaaggggccgccgttc
accgggccggtgttcagcgacgacctgtccagcatggccgccatctccgaccggtacggg
gtctccgaggcggtgctgcggaccctgctggccggcgtcgacatcgcgctgtgggtcacc
accgatgaggtgccggcggtcctggaccggctgcaaaaggccgtggcctcaggcgaattg
ccggctcaacgggtcgacgaggcgctggtgcgggtggcgaagatgaagggtcccggcccg
gcctgcgggcactag

DBGET integrated database retrieval system