KEGG   Modestobacter marinus: MODMU_0321Help
Entry
MODMU_0321        CDS       T02167                                 

Definition
(GenBank) Acyl-CoA dehydrogenase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mmar  Modestobacter marinus
Pathway
mmar00071  Fatty acid degradation
mmar00410  beta-Alanine metabolism
mmar00592  alpha-Linolenic acid metabolism
mmar00640  Propanoate metabolism
mmar01040  Biosynthesis of unsaturated fatty acids
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01200  Carbon metabolism
mmar01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MODMU_0321
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MODMU_0321
   00592 alpha-Linolenic acid metabolism
    MODMU_0321
   01040 Biosynthesis of unsaturated fatty acids
    MODMU_0321
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MODMU_0321
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     MODMU_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: CCH85783
UniProt: I4EQX0
Position
complement(326624..328666)
Genome map
AA seq 680 aa AA seqDB search
MTSTPAPLTPVDPARLTEVLDGRWAQVRRDAREQLGSARYAPVYGESMPQARERVTALTR
ELAATGRVSLGFPRKYGGADDAGGSVVSVEMLAFADLSLMVKAGVQWGLFGGAVQALGTK
RQHDAYLPDIMSFALPGCFAMTETGHGSDVQQLRTTCTYDPATQTFDLHTPHEAARKDYI
GNAAQDGRMAVVFAQLVTLGEGRGVHAFLVPIRDEDGAPMPGVTIGDDGPKAGLLGVDNG
RLSFDHVTVPRDMLLDRYGQVAADGTYTSTIANETRRFFTMLGTLVRGRVSVGGSAGSAT
KVALEIAVRYGDVRRQFAAPGEDREVVVNDYRVHQRKLLPALATTYALHFAQEELVSRMH
DVLGAGEVDEAAQRELESRAAGLKVANTWHATRTIQLAREACGGAGYLAENRLPALKADT
DVFTTFEGDNTVLLQLVAKGLLTGYRDAFGSLDGWGRAQFVAEQVRETVLERTAARALIQ
RLVDAVPGRDDDVALTDRGWQLRALEDREKHVLGGAIKRLRKGAATPGTRPFDVFNDVQD
HVLAAAQAHIDRIVLEAFVAGIERTADPAARALLSRVCDLYALSTIEADKGWFLEHGRLT
PTRAKALTGAVNDLLGELRPHMRTLVDAFAVPEAWLNCAVLAEEPGRQQAMAEHDAALRA
AGAEPQQDATATDLQMAPAQ
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcacccccgcccccctcaccccggtcgaccccgcgcggctgaccgaggtcctc
gacggccggtgggcgcaggtccgccgcgacgcgcgggagcagctcggcagcgcccggtac
gcgccggtctacggcgagtcgatgccgcaggcgcgggagcgggtgaccgcgctgacccgg
gagctcgccgccaccggccgggtctccctcggcttcccccgcaagtacggcggcgcggac
gacgccggcggctcggtggtgtcggtggagatgctcgccttcgccgacctgtcgctgatg
gtcaaggccggcgtccagtgggggctgttcggtggcgccgtccaggcgctgggcacgaag
cgccagcacgacgcctacctgcccgacatcatgagcttcgcgctgccgggctgcttcgcg
atgaccgagaccgggcacggctccgacgtccagcagctgcggacgacgtgcacctacgac
ccggccacgcagaccttcgacctgcacaccccgcacgaggccgcccgcaaggactacatc
ggcaacgcggcgcaggacggccggatggcggtcgtcttcgcgcagctggtcaccctcggc
gagggccggggcgtgcacgccttcctcgtgccgatccgcgacgaggacggcgcgcccatg
ccgggtgtcacgatcggcgatgacggccccaaggccgggttgctcggcgtcgacaacggc
cggctcagcttcgaccacgtgaccgtcccgcgggacatgctgctggaccgctacggccag
gtcgccgccgacggcacgtacacctcgaccatcgccaacgagacccggcgcttcttcacc
atgctcggcacgctggtgcgcggtcgggtcagcgtcggcggctcggccggttcggcgacg
aaggtggcgctggagatcgccgtccgctacggcgacgtccgccgccagttcgccgccccg
ggcgaggaccgggaggtcgtggtcaacgactaccgggtgcaccagcgcaagctgctgccc
gccctggcgacgacgtacgcgctgcacttcgcccaggaggagctcgtctcccggatgcac
gacgtgctgggcgccggcgaggtcgacgaggcggcgcagcgcgagctggagtcgcgggcc
gccgggctcaaggtcgcgaacacctggcacgccacccggaccatccagctggcccgcgag
gcctgcggcggcgccggctacctggccgagaaccggctgccggcgctcaaggccgacacc
gacgtgttcaccaccttcgagggcgacaacaccgtcctgctgcagctggtcgccaagggc
ctgctcaccggctaccgggacgccttcggctcgctggacggctggggccgcgcgcagttc
gtcgccgagcaggtgcgcgagacggtgctggagcgcaccgccgcccgggcgctgatccag
cggctcgtcgacgccgtccccggccgggacgacgacgtcgccctcaccgaccgcggctgg
cagctccgggcgctggaggaccgggagaagcacgtgctgggcggcgcgatcaagcggctg
cgcaagggcgcggcgacgccggggacgcgtccgttcgacgtcttcaacgacgtgcaggac
cacgtgctggcggccgcgcaggcgcacatcgaccggatcgtgctggaggccttcgtcgcc
ggcatcgagcgcacggccgacccggccgcccgcgcgctgctgagccgggtctgcgacctg
tacgcgctgagcacgatcgaggcggacaagggctggttcctggagcacggccggctcacc
cccacccgcgccaaggcgctgaccggcgcggtgaacgacctgctcggcgagctgcgcccg
cacatgcggacgctggtcgacgccttcgccgtccccgaggcctggctcaactgcgccgtc
ctggccgaggagccgggccgccagcaggccatggccgagcacgacgccgccctgcgcgcg
gccggcgccgagccccagcaggacgccaccgccaccgacctgcagatggcccccgcccag
taa

DBGET integrated database retrieval system