KEGG   Modestobacter marinus: MODMU_0571Help
Entry
MODMU_0571        CDS       T02167                                 

Gene name
bglB
Definition
(GenBank) Thermostable beta-glucosidase B
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
mmar  Modestobacter marinus
Pathway
mmar00460  Cyanoamino acid metabolism
mmar00500  Starch and sucrose metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MODMU_0571 (bglB)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    MODMU_0571 (bglB)
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     MODMU_0571 (bglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: CCH86028
UniProt: I4ERL5
Position
complement(573972..575369)
Genome map
AA seq 465 aa AA seqDB search
MTSTDVRPDTATGLSFPPGFTFGAATASYQIEGAVDVDGRGPSIWDTFSHTPGRTHLGHT
GDVAVEHYVRYPQDVALMKDLGLDAYRFSVAWPRVLPTGAGAVEQRGLDFYRRLTDELLE
AGIAPWLTLYHWDLPQALQDRGGWADRDTALRFADYAGVVYDALGDRVPHWSTLNEPMCS
SLLGYMAGQHAPGHQDAVEASRAVHHLLLGHGLATQVLRDKGADHLGITLNFTPMSPATD
SPADVDAARRLDGQQNRMFLVPIVTGEYPADVAADLAAAGAPLPIEDGDLEVISTPLDWL
GVNYYFRSVVQAVAEPTGKASPFIGAERVQDLEPAGPTTTMGWGINPEGFTELLLRLRDL
APGLPLFITENGSAWPDQVSADGAVHDPERVDYLLRHLAAMTEAIDAGADVRGYFAWSLL
DNYEWARGYDQRFGLVHVDYETQVRTPKDSAHAYAEVLRQHRDGV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccgacgtgcgcccggacaccgccaccggcctgtccttcccgcccggtttc
accttcggcgccgccaccgccagctaccagatcgagggcgcggtggacgtcgacggtcgc
gggccctcgatctgggacaccttcagccacaccccgggcaggacccacctgggccacacc
ggcgacgtcgccgtcgagcactacgtccggtacccgcaggacgtcgcgctgatgaaggac
ctcggtctggacgcctaccggttctccgtcgcctggccgcgggtgctccccaccggcgcg
ggcgcggtcgagcagcgcgggctggacttctaccgccggttgaccgacgagctgctcgag
gcgggcatcgccccctggctgacgctgtaccactgggacctgccgcaggcgctgcaggac
cgcggcgggtgggccgaccgggacaccgcgctgcgcttcgccgactacgccggggtggtt
tacgacgccctcggcgaccgggtcccgcactggtcgacgctgaacgagccgatgtgcagc
tcgctgctcggctacatggccggccagcacgcccccggccaccaggacgccgtcgaggcc
tcccgcgcggtgcaccacctgctgctcgggcacggcctggccacccaggtgctgcgcgac
aagggcgcggaccacctgggcatcacgctgaacttcacgccgatgtcgccggccaccgac
tcccccgccgacgtcgacgccgcccgccgcctcgacgggcagcagaaccggatgttcctc
gtcccgatcgtcaccggcgagtacccggccgacgtcgccgcggacctggcggcggccggc
gcaccgctgccgatcgaggacggcgacctggaggtcatctccacgccgctggactggctg
ggggtcaactactacttccgctccgtcgtgcaggccgtcgccgagcccaccggcaaggcc
agccccttcatcggtgccgagcgggtgcaggacctggagccggcgggcccgaccaccacc
atgggctggggcatcaaccccgagggcttcaccgagctgctcctccggctgcgcgacctg
gcgccgggcctgccgctgttcatcaccgagaacggctcggcctggccggaccaggtctcc
gcggacggcgcggtccacgacccggagcgggtcgactacctgctgcgccacctggccgcg
atgaccgaggcgatcgacgccggagccgacgtccggggctacttcgcctggtcgctgctg
gacaactacgagtgggcccgcggctacgaccagcgcttcggcctggtgcacgtggactac
gagacccaggtgcggacgccgaaggacagcgctcacgcctacgccgaggtgctccgccag
caccgggacggcgtatga

DBGET integrated database retrieval system