KEGG   Modestobacter marinus: MODMU_2432Help
Entry
MODMU_2432        CDS       T02167                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mmar  Modestobacter marinus
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MODMU_2432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TMEM141
Motif
Other DBs
NCBI-ProteinID: CCH87861
UniProt: I4EWU8
Position
complement(2390545..2391672)
Genome map
AA seq 375 aa AA seqDB search
MDASLIVVVVVVTALVFDFTNGFHDTANAMATSIATGAFRPRTAVTIAACLNVVGAFLSV
QVANTISGGLVDETLIDPVVVFAGLVGAILWNLVTWYLGLPSSSSHALFGGLIGATWVAG
GVGAIDFDAVLNKIVLPAVLSPVVAALIAVVVTYLAFRISARADPGTVDRGFTVAQRVSA
SMVALAHGTNDAQKTMGVITLTLITSGMLAPGSGPPSWVVLAAGLAIGLGTYMGGWRIIR
TLGNRVSDIHLVQGFTAETTSTAVILSSTHLGLPLSTTQVCTGSILGAGAGRRLASVHWG
MAGRIALAWTFTLPSAAVVGAGASWLAATGTAGVAVVALTGITLAAGLYAASRRDAVSAT
NVNDRPLPAAVDVPA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacgcatcgctcatcgtcgtcgtggtggtcgtgaccgcgctggtcttcgacttcacg
aacggcttccacgacacggccaacgccatggccacctccatcgcgaccggtgcgttccgg
ccccggaccgccgtgacgatcgccgcctgcctgaacgtggtcggggccttcctctcggtc
caggtggccaacaccatctccggcgggctggtcgacgagacgctcatcgacccggtggtg
gtcttcgccgggctggtcggggccatcctgtggaacctggtgacctggtacctcgggttg
ccgtccagctcgtcgcacgcgctgttcggcggtctgatcggcgcgacctgggtggccggc
ggcgtcggcgcgatcgacttcgacgcggtgctcaacaagatcgtgctccccgccgtgctg
tcgcctgtggtcgccgcgctgatcgccgtcgtcgtcacctacctggccttccggatctcc
gcgcgggccgacccgggcaccgtggaccgcgggttcacggtcgcccagcgcgtctcggcg
tcgatggtcgcgctcgcgcacggcaccaacgacgcgcagaagaccatgggcgtgatcacc
ttgaccctgatcacctcgggcatgctcgcgcccggctcgggaccaccttcgtgggtcgtc
ctggccgccgggctggcgatcgggctgggcacctacatgggcggctggcggatcatccgg
accctcggcaaccgggtcagcgacatccacctggtgcagggcttcaccgccgagacgacc
agcaccgcggtcatcctgtcctcgacccacctcgggctgccgctgtccaccacgcaggtg
tgcaccggctcgatcctcggcgcgggtgccggacggcggctggcctcggtgcactggggg
atggccgggcggatcgcgctggcctggaccttcaccctgccgtccgcggccgtcgtgggc
gccggcgcctcctggctggccgcgaccggcacggccggcgtggccgtcgtcgcgctgacc
ggcatcaccctggccgccggcctctacgccgcgtcgcggcgcgacgcggtcagcgccacc
aacgtcaacgaccggccgctgccggcggccgtcgacgtccccgcctga

DBGET integrated database retrieval system