KEGG   Modestobacter marinus: MODMU_3035Help
Entry
MODMU_3035        CDS       T02167                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mmar  Modestobacter marinus
Pathway
mmar00030  Pentose phosphate pathway
mmar00480  Glutathione metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01120  Microbial metabolism in diverse environments
mmar01130  Biosynthesis of antibiotics
mmar01200  Carbon metabolism
Module
mmar_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mmar_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MODMU_3035
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MODMU_3035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmar04147]
    MODMU_3035
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     MODMU_3035
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     MODMU_3035
Exosome [BR:mmar04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MODMU_3035
  Exosomal proteins of colorectal cancer cells
   MODMU_3035
  Exosomal proteins of bladder cancer cells
   MODMU_3035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: CCH88461
UniProt: I4EYJ8
Position
complement(3024361..3025797)
Genome map
AA seq 478 aa AA seqDB search
MARDRAGENVPTPSGSGSGEGAGPGSAGTSTLLVLGACGDLAARLLLPGLGGLLTQREVG
DLFLVGSDTAEWSDDQWRQRVSESFATVSANGKQADEVVRSCRYLRADVTDEDHLRRLLD
ACTGQVTIYFALPPAVTARACGLLADLGVPEDTRLVMEKPFGTDGPSAHELNELVTRLVP
ENQVYRVDHYLGMSTVLNMLGMRFANRMLESVLDAENVSSVDIVFDESLGLEGRAGYYDG
AGALVDMIQSHALQVLALLTMEAPSTLGAEDLQDAKSRVLRATSLWDEDPVRYSRRARYT
AGTIGERRLPAYVDEEGVDPARRTETFAEVVVAVNTWRWAGVPFRLRAGKALSALRKEAV
ITFKGPRWVPEGLAGYEQPDRMRIGFDPDLVGLDFNLNGPGDPFTVDRVSLESPSGPGDL
PPYGEVLAEVLGGDPTMSVRGDQAEQAWRIVAPVRAAWRDDRVELEEYPAGSDGPGAP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgaccgagccggagagaatgtgccgacgccgtccggatcaggaagcggcgaa
ggagcaggtcccgggtccgcgggcacgagcacgctgctggtgctcggggcctgcggcgac
ctggctgcgcggctgttgctgcccggtctaggcgggctcctgacccagcgcgaggtcggc
gacctgttcctcgtgggcagcgacacggccgagtggagcgacgaccagtggcgccagcgg
gtctccgagtcctttgccacggtgtccgcgaacgggaagcaggccgacgaggtggtccgg
agctgtcggtatctccgtgccgacgtcaccgacgaagaccacctgcgtcgactgctcgat
gcctgcaccgggcaggtcaccatctacttcgccctgccaccggccgtcaccgcacgagcc
tgcgggctgctcgcggacctcggcgtcccggaggacacccggctcgtcatggagaagccc
ttcggcaccgatgggcccagtgcgcacgagctcaacgagctggtgacccggctggtgccg
gagaaccaggtgtaccgggtcgaccactacctgggcatgtccaccgtcctcaacatgctc
gggatgcgcttcgccaaccgcatgctggagtcggtgctggacgcggagaacgtcagcagc
gtggacatcgtcttcgacgagagcctcggcctggaaggccgggcgggctactacgacggc
gccggcgcgctcgtcgacatgatccagagccacgcgctccaggtgctcgcactgctgacc
atggaggcgccgagcacgctgggcgcggaagacctgcaggacgccaagtcgcgggtgctc
cgggcgaccagcctgtgggacgaggacccggtgcgctacagccgccgggctcgctacacc
gcgggcacgatcggtgagcgacgcctgccggcctacgtcgacgaggagggggtggacccc
gcccggcgcacggagacctttgccgaggtggtggtggcggtcaacacgtggcgttgggcc
ggtgtgccgttccggctccgggcgggcaaggcgctgagcgcgctgcgcaaggaagcagtg
atcacgttcaaagggccgcgctgggtgccggagggactcgccgggtacgagcagccagac
cggatgcgcatcggcttcgatcccgacctggtgggtctggacttcaacctcaacggtccg
ggcgaccccttcacggtcgaccgggtgtcgctggagtcgccgtccggcccgggcgatctc
ccgccgtacggagaggtgctcgccgaggtgctgggcggcgatcccacgatgtcggtgcgc
ggggaccaggcggagcaggcatggcgcatcgtcgcgcccgtgcgcgcggcctggcgggac
gaccgggtggagctcgaggagtacccagccggcagcgatggaccaggcgccccatag

DBGET integrated database retrieval system