KEGG   Modestobacter marinus: MODMU_3399Help
Entry
MODMU_3399        CDS       T02167                                 

Gene name
ELI
Definition
(GenBank) Tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mmar  Modestobacter marinus
Pathway
mmar00350  Tyrosine metabolism
mmar00360  Phenylalanine metabolism
mmar00380  Tryptophan metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MODMU_3399 (ELI)
   00360 Phenylalanine metabolism
    MODMU_3399 (ELI)
   00380 Tryptophan metabolism
    MODMU_3399 (ELI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmar04147]
    MODMU_3399 (ELI)
Enzymes [BR:mmar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     MODMU_3399 (ELI)
    4.1.1.105  L-tryptophan decarboxylase
     MODMU_3399 (ELI)
Exosome [BR:mmar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MODMU_3399 (ELI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 SepSecS Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCH88811
UniProt: I4EZJ8
Position
3378102..3379829
Genome map
AA seq 575 aa AA seqDB search
MTGHMTPEQFRQHGHEVVDWIADYWERIGSFPVRSQVSPGDVRASLPPTAPEQGEPFSAV
LADLDRVVLPGVTHWQHPGFFGYFPANTSGPSVLGDLVSAGLGVQGMSWVTSPAATELEQ
HVMDWFADLLGLPESFRSTGSGGGVVQDSSSGANLVALLAALHRASKGATLRHGVRPEDH
TVYVSAETHSSMEKAARIAGLGTDAIRIVEVGPDLAMNPRALAQRLERDVARGYTPVLVC
ATVGTTSTTAIDPLAELGPICQQHGVWLHVDAAYAGVSAVAPELRALQAGVEWADSYTTD
AHKWLLTGFDATLFWVADRAALTGALSILPEYLRNAATDTGAVVDYRDWQIELGRRFRAL
KLWFVVRWYGAEGLREHVRSHVALAQELAGWADADERFDVAAPHPFSLVCLRPRWAPGID
ADVATMTLLDRLNDGGEVFLTHTTVDGAAVLRVAIGAPATTREHVERVWALLGEAHDWLA
RDFEEQAAERRAAELREREAAEEQLRARREAEAAAAAATEAPVEPAAEEPEQLVVPPVEV
PAVETPAAWDESATQVAAQTDLHADPAPQPADGQG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggccacatgacccctgagcagttccgccagcacggccacgaggtcgtggactgg
atcgccgactactgggagcgcatcggctccttcccggtccgctcgcaggtctcccccggt
gacgtccgcgcctcgctgccgccgaccgcgccggagcagggcgagccgttctccgccgtc
ctggccgacctggaccgggtcgtgctgcccggcgtcacccactggcagcaccccgggttc
ttcggctacttcccggccaacacctccgggccctcggtgctcggcgacctggtgtccgcc
ggcctcggcgtgcagggcatgtcctgggtgaccagcccggccgccacggagctcgagcag
cacgtcatggactggttcgccgacctgctgggcctgccggagtccttccgctccaccggc
agcggcggcggcgtcgtgcaggactccagctccggcgccaacctggtcgccctgctggcg
gccctgcaccgggccagcaagggcgcgaccctgcggcacggcgtccggcccgaggaccac
accgtctacgtctccgccgagacgcacagctcgatggagaaggcggcccggatcgccggg
ctgggcaccgacgccatccggatcgtcgaggtcggccccgacctggcgatgaacccgcgg
gcgctggcccagcggctcgaacgggacgtcgcccggggctacaccccggtcctggtctgc
gccacggtcgggacgacgtcgaccaccgcgatcgacccgctcgccgagctcggcccgatc
tgccagcagcacggggtgtggctgcacgtcgacgccgcctacgccggggtcagcgccgtc
gccccggagctgcgcgcgctgcaggccggtgtcgagtgggccgacagctacaccaccgac
gcgcacaagtggctgctcaccggcttcgacgcgacgctgttctgggtcgccgaccgggcc
gccctcaccggggccctgtcgatcctcccggagtacctgcgcaacgccgccaccgacacc
ggcgcggtcgtcgactaccgcgactggcagatcgagctgggccgccggttccgcgccctc
aagctgtggttcgtcgtccgctggtacggcgccgagggcctccgcgagcacgtccgcagc
cacgtcgccctggcccaggagctggccggctgggcggacgccgacgagcgcttcgacgtc
gccgccccgcacccgttctcgctggtctgcctgcggccgcggtgggcaccggggatcgac
gccgacgtcgccaccatgaccctgctcgaccggctcaacgacggcggcgaggtcttcctg
acccacaccaccgtcgacggcgccgcggtgctgcgggtggccatcggcgcaccggcgacc
acccgggagcacgtcgagcgggtctgggcgctgctgggcgaggcgcacgactggctggcg
cgggacttcgaggagcaggccgccgagcgccgggcggccgagctccgcgagcgggaggcc
gccgaggagcagctccgcgcccgccgggaggccgaggccgcggcagcggccgccaccgag
gcgccggtggagccggcggccgaggagcccgagcagctcgtcgtcccgccggtggaggtc
cccgccgtcgagaccccggcggcctgggacgagtcggccacccaggtggccgcccagacc
gacctgcacgccgacccggctccgcagccggccgacggccagggctga

DBGET integrated database retrieval system