KEGG   Modestobacter marinus: MODMU_3441Help
Entry
MODMU_3441        CDS       T02167                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mmar  Modestobacter marinus
Pathway
mmar00020  Citrate cycle (TCA cycle)
mmar00620  Pyruvate metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01120  Microbial metabolism in diverse environments
mmar01130  Biosynthesis of antibiotics
mmar01200  Carbon metabolism
Module
mmar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MODMU_3441 (mqo)
   00620 Pyruvate metabolism
    MODMU_3441 (mqo)
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MODMU_3441 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCH88853
UniProt: I4EZP0
Position
3426997..3428451
Genome map
AA seq 484 aa AA seqDB search
MVLVGGGIMSATLAALLGIVAPDWTVEVFESGAAVAEESSGPWNNAGTGHSALCELNYTP
ARPDGTVDPAKAVGINEQFQVSRQFWSHLVRAGLTDSPKTFITSVPHISFVSGEEGRRYM
RNRYEALAPQPLFAGLEYSDDPAVLTDWVPLMMQDRSPKEPVAATRSLAGTDVNFGALTR
LLLDDAVRRGVQLHLQHRVLKVRRERDGRWATTVRDLATGKRRTVRSRFLFVGAGGGALP
LLQGAGIPEIAGFGGFPVSGQFLRTRNPQLVAQHQAKVYGQAKVGAPPMSVPHLDLRLID
GEQALLFGPYAGFSPKFLKAGSMWDLPRSVRTGNLGSMLGAGWANIPLTRYLIGQVLQSE
KSRFRALEEFVPTAEQDDWELITAGQRVQVIKQDTAGRGVLQFGTELIVGADGTVAGLLG
ASPGASTATAAMLTLLERCFPDRIDGWRPLLQEAIPSYGHTLSDEPELLARVVADTTRTL
ELHS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtggtcctcgtcggcggcggcatcatgagcgcgacgctggccgcgctgctgggcatcgtc
gcgccggactggaccgtcgaggtgttcgagtccggcgccgccgtggccgaggagagctcc
ggcccgtggaacaacgccgggaccgggcactccgcgctgtgcgagctgaactacaccccg
gcgcggcccgacggcaccgtcgacccggccaaggccgtgggcatcaacgagcagttccag
gtctcccggcagttctggtctcacctggtgcgggccggcctcaccgactccccgaagacg
ttcatcacctcggtgccgcacatcagcttcgtctccggcgaggagggccgccggtacatg
cgcaaccggtacgaggcgctggccccgcagccgctcttcgccggcctggagtactccgac
gaccccgccgtcctgaccgactgggtgccgctgatgatgcaggaccggtcgccgaaggag
ccggtcgcggcgacccggtcgctggccggcaccgacgtcaacttcggcgcgctgacccgg
ctgctgctcgacgacgccgtccgccgcggggtgcagctgcacctgcagcaccgggtgctc
aaggtgcggcgcgagcgcgacgggcgctgggccaccacggtccgcgacctggccaccggc
aagcgtcgcaccgtgcgcagccggttcctgttcgtcggggccggcggtggggcgctgccg
ctgctgcagggcgccggcatcccggagatcgcgggcttcggcggcttcccggtcagcggc
cagttcctgcgcacccgcaacccgcagctggtcgcccagcaccaggcgaaggtctacggc
caggcgaaggtgggtgccccgccgatgtcggtgccgcacctggacctgcggctgatcgac
ggcgagcaggcgctgctgttcggcccctacgccggcttctcccccaagttcctcaaggcc
gggtcgatgtgggacctcccgcggtcggtgcggacgggcaacctcggctccatgctcggc
gcgggctgggcgaacatcccgctcacccgctacctcatcggccaggtgctccagtcggag
aagtcccgcttccgggcgctggaggagttcgtcccgaccgccgagcaggacgactgggag
ctcatcaccgccggccagcgggtgcaggtgatcaagcaggacaccgccgggcgcggcgtg
ctgcagttcggcaccgagctcatcgtcggggccgacgggacggtcgccgggctgctcggc
gcctccccgggcgcctccaccgccaccgcggcgatgctcacgctgctcgagcgctgcttc
cccgaccggatcgacggctggcgcccgctgctgcaggaggccatcccctcctacgggcac
acgctgtccgacgagcccgagctgctcgcccgggtcgtcgccgacaccacccgcaccctg
gagctgcacagctga

DBGET integrated database retrieval system