KEGG   Modestobacter marinus: MODMU_3886Help
Entry
MODMU_3886        CDS       T02167                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mmar  Modestobacter marinus
Pathway
mmar00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MODMU_3886
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MODMU_3886
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MODMU_3886
    1.1.1.-  
     MODMU_3886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ApbA
Motif
Other DBs
NCBI-ProteinID: CCH89289
UniProt: I4F0X6
Position
3855165..3856208
Genome map
AA seq 347 aa AA seqDB search
MKAVVCAPDAPEGTAVTDVPDPAPEPGEVVVEVNACGLCGSDVHAIEHGRTVEGQILGHE
FGGHVVEVGPEARGWRVGQAVAVNPLGACGRCRACRKELPFRCTAAPNLGITAPGGYAEY
VAVPADQLVAMPDGAPVEWGAHAEPLAVALRAVALAAVGPADSVLVYGVGAIGLNAIFAL
RAAGVESVVGAGRSPGRRHAAAAAGADIVLDTRAVSVREHVARTGRRFDAVLECSAAEGA
VEESMDVLAPGGTCVVVALTSAAAKVPLGPLVGEGLGLVGSCAFRPIDFTAAVAHVTSGR
LPVADLISERVGLQETPDALVRLRRPGDLVRVLTVPGADSRGPDPAG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtcgtctgcgccccggatgcccccgagggcaccgcggtcaccgacgtcccc
gaccccgcgccggagcccggcgaggtggtggtcgaggtcaacgcctgcggcctgtgcggc
agcgacgtgcacgcgatcgaacacggccggacggtcgagggtcagatcctgggtcacgag
ttcggtggccacgtggtcgaggtgggtccggaagcgcgcggatggcgagtggggcaagcc
gtggccgtcaaccccctgggagcgtgcggccggtgccgcgcgtgccgcaaggagttgccc
ttccgctgcaccgccgcacccaacctcggcatcaccgcgcccggcggatacgccgagtac
gtggccgtgcccgccgaccaactcgtcgccatgcccgacggagcccccgtggagtggggc
gcccacgccgagccgctcgccgtggcgttgcgcgccgtcgcgctggccgctgtgggccct
gccgacagcgtgctggtgtacggggtgggcgcaatcggcctgaacgcgatcttcgccttg
cgggcggcgggggtcgagtccgtggtcggtgcgggacgctcccccggacgtcgccacgcc
gctgcggcagccggtgccgacatcgtcctggacacccgcgcggtcagtgtccgcgagcac
gtcgcccgcaccggccggcggttcgacgcagtcttggagtgctcggcggccgagggcgcg
gtcgaggagtcgatggacgtgctggcgcccggcggcacgtgcgtggtcgtggcgctgacc
agcgcggccgcgaaggtcccgctgggcccactcgtcggcgagggcctgggcctcgtcggc
agctgcgcgttccgcccgatcgacttcactgcggcggtcgcccacgtgaccagcgggcgc
ctaccggttgcggatctgatcagcgagcgcgtcggactgcaggagacgcctgatgcgctg
gtccggctccggcgacccggcgacctcgtgcgggtgctgaccgtccccggcgccgactcc
cgggggcctgacccggccggctga

DBGET integrated database retrieval system