KEGG   Modestobacter marinus: MODMU_3996Help
Entry
MODMU_3996        CDS       T02167                                 

Definition
(GenBank) putative (S)-2-haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mmar  Modestobacter marinus
Pathway
mmar00361  Chlorocyclohexane and chlorobenzene degradation
mmar00625  Chloroalkane and chloroalkene degradation
mmar01100  Metabolic pathways
mmar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MODMU_3996
   00361 Chlorocyclohexane and chlorobenzene degradation
    MODMU_3996
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     MODMU_3996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: CCH89399
UniProt: I4F186
Position
3966072..3967046
Genome map
AA seq 324 aa AA seqDB search
MALDAPVTAVVFDVLGTLLDEDRARADAVRRALPQLADGAAGLAAEWDERGGRVRAAIAA
GELPFQMADDVEQAALTEVLDAHGLQLPGRETAELARFGYRIEPFPGTTEALAALRAELP
VVALTNAGLGQAGAMFANVGWEWTAVVSAESVAAYKPDPRMYRQALEVLGLPAEQVVLVA
AHPWDLRAAAGEGLRTAYLDRGTGGDGSGFDLTGPDLAALVGQLTSSTRRSRTYLPVPRR
TFVAAGCSASPTGRRTTATGRRPKSTGCAQPARGSEGRRSAEPSMPSTSTAASTAISATV
PSAVGSPACSARNPMTGGPPSRPV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcactggacgcgccggtcaccgccgtcgtcttcgacgtcctcggcacgttgctggac
gaggaccgggcgcgggccgacgcggtgcggcgggccctcccgcagctcgccgacggcgcc
gccgggctcgccgccgagtgggacgagcgcggcggccgggtccgggcggccatcgcggcc
ggggagctgccgttccaaatggccgacgacgtggagcaggcggccctcaccgaggtcctc
gacgcccacgggctgcagctgcccgggcgggagacggccgagctggcccgcttcgggtac
cgcatcgagccgttcccggggacgacggaggcgctggccgcactccgcgccgagctgccc
gtcgtcgcgctgaccaacgccgggctgggccaggcgggcgccatgttcgccaacgtcggg
tgggagtggaccgccgtcgtctcggccgagtcggtggccgcctacaagcccgacccgcgg
atgtaccggcaggccctggaggtgctggggctgccggccgagcaggtcgtgctcgtcgcc
gcccacccctgggacctccgggccgccgccggggagggcctgcggacggcctacctggac
cgcgggacgggcggcgacggcagcggcttcgacctgaccggcccggacctcgccgcgctg
gtcggtcagctgacctcgagcacccgcaggtcgcggacgtatctgccggtgccgcggcgc
acctttgtcgccgccggctgcagcgcgtcgcccacggggcgcaggaccaccgccaccgga
cgacgaccgaagagcaccggctgcgcccagccggcccgcggcagcgagggccggcgcagc
gcggagccctcgatgccgagcaccagcacggcggcgagcacggccatcagcgcgaccgtg
ccgagcgcggtgggcagcccggcgtgctcggcgaggaacccgatgaccggcgggccgccg
agcaggccggtgtag

DBGET integrated database retrieval system