KEGG   Modestobacter marinus: MODMU_5199Help
Entry
MODMU_5199        CDS       T02167                                 

Definition
(GenBank) zinc-type alcohol dehydrogenase-like protein yycR
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mmar  Modestobacter marinus
Pathway
mmar00625  Chloroalkane and chloroalkene degradation
mmar00680  Methane metabolism
mmar01100  Metabolic pathways
mmar01120  Microbial metabolism in diverse environments
mmar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MODMU_5199
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MODMU_5199
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MODMU_5199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP 2-Hacid_dh_C FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CCH90576
UniProt: I4F4L3
Position
complement(5189540..5190781)
Genome map
AA seq 413 aa AA seqDB search
MAGNRGVAYIEPGKVEVQQTDYPKLELQDGPGVNPANIGRKLNHGVILKVVTTNICGSDQ
HMVRGRTTAPPNLVLGHEITGEVVEKGSDVEFIQVGDVCSVPFNIACGRCRNCKEGKTGI
CLNVNPARPGAAYGYVDMGGWVGGQAEYVTVPYADWNLLKFPDRDQALAKILDLTMLSDI
FPTGYHGCYTAGVTTGSTVYIAGAGPVGLAAAASAQLLGAAVVIVGDLNKERLEQARSFG
CETVDVSAGTPQEQVEQILGVPEVDAAVDAVGFEARGHGHDSTHEAPATVLNSLMELTAA
GGQIGIPGLYVTGDPGGIDDAAKVGALSLSLGTGWAKSLSFTTGQCPVMKYNRKLMMAIL
HDRVQIAKAVNATVITLDDAPRGYQEFDSGAAKKYVIDPHGMVKGSAGNGRAA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaacagaggcgttgcgtacatcgagcccggcaaggtcgaggtccagcagacc
gactacccgaagttggaactccaggacggtccgggggtgaacccggccaacatcgggcgg
aagctgaaccacggcgtgatcctcaaggtggtcaccaccaacatctgcggcagcgaccag
cacatggtccgcggccgcaccacggcaccgccgaacctggtgctcgggcacgagatcacc
ggcgaggtggtcgagaagggctcggacgtcgagttcatccaggtcggcgacgtgtgctcg
gtgccgttcaacatcgcctgcgggcgctgtcggaactgcaaggagggcaagacggggatc
tgcctgaacgtcaacccggcccgtcccggtgctgcctacggctacgtcgacatgggcggc
tgggtcggcgggcaggccgagtacgtcacggtcccctacgcggactggaacctgctcaag
ttccccgaccgggaccaggcgctggccaagatcctggacctgacgatgctctcggacatc
ttcccgaccgggtaccacggctgctacacggccggggtgaccaccgggtcgacggtgtac
atcgccggcgcggggccggtcggcctggcagcggcggcatcggcgcagctgctcggcgcc
gccgtggtgatcgtcggtgacctgaacaaggagcggctggagcaggcgcgcagcttcggc
tgcgagacggtcgacgtctccgcgggcaccccgcaggagcaggtcgagcagatcctcggc
gtacccgaggtggacgccgcagtcgacgcggtcggcttcgaggcccgcggacacgggcac
gactcgacccacgaggccccggcgacggtgctcaactcgctcatggagctcaccgcggcc
ggcggtcagatcggcatcccggggctctacgtcaccggtgacccgggtgggatcgacgac
gccgcgaaggtcggggcgctgtcgctctcgctgggcaccggctgggcgaagtcgctctcg
ttcaccaccggccagtgcccggtcatgaagtacaaccgcaagctgatgatggcgatcctg
cacgaccgggtgcagatcgcgaaggcggtcaacgccacggtcatcacgctggacgacgcc
ccgcgggggtaccaggagttcgactccggggcggcgaagaagtacgtcatcgacccgcac
gggatggtcaagggcagcgcgggcaacggacgcgccgcctag

DBGET integrated database retrieval system