KEGG   Myxococcus macrosporus: MYMAC_000046Help
Entry
MYMAC_000046      CDS       T05096                                 

Definition
(GenBank) glucose dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00030  Pentose phosphate pathway
mmas01100  Metabolic pathways
mmas01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MYMAC_000046
Enzymes [BR:mmas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     MYMAC_000046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N AlaDh_PNT_C ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ATB44475
UniProt: A0A250JKS0
Position
51380..52465
Genome map
AA seq 361 aa AA seqDB search
MKAVAVFPQQREVRVITDAPEPRIQSPTQVKVRTREVGVCGTDKEIIEFKHGAPPPGSDH
LILGHECLGEVVEVGEAVKGLSRGDWVVPRVRRPCPHATCPPCRSGHPDFCITGDYTERG
IKGAHGFAAESFVEDVAYLHRVPTELREVAVLTEPLTIAEKALRQLEHLQERLPWKIGPG
RAVVLGAGPVGQLGAMALVRRGYATTMYSRSPKPNVKAEASEALGVPYVSSKEVRPEELV
RRVGAADVIYEAAGVAKAALETLKALGPNGVCILTGVPSQEEPFDVAPVLKGVVLGNQVL
LGTVNAADVDFDMALEDLRHFQARWPGQLERFICSKHTPEDFCDVVTGKKSGGIKDVIRF
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtggccgtcttcccccagcagcgcgaggtgcgcgtcatcaccgacgccccc
gagccccgcatccagtcccccacgcaggtgaaggtgcggacgcgggaagtcggggtgtgt
ggcacggacaaggaaatcatcgagttcaagcatggcgccccgccgccgggctcggaccac
ctcatcctgggccacgagtgcctgggcgaggtcgtggaggtgggcgaggccgtcaagggc
ctgagccgtggggactgggtggtgccgcgcgtgcgccgcccgtgcccgcacgccacctgc
ccgccatgccgctcgggccacccggacttctgcatcaccggggactacacggagcggggc
atcaagggcgcccacggcttcgccgcggagtccttcgtggaggacgtggcctacctgcac
cgcgtgcccacggagctgcgcgaggtggccgtgctcaccgagccgctcaccatcgcggag
aaggccctccggcagttggagcacctccaggagcggctgccctggaaaatcggaccgggc
cgcgcggtggtgctgggcgcggggccggtgggccagctgggcgccatggcgctggtgcgg
cggggctatgccaccaccatgtactctcgcagccccaagccgaacgtgaaggcggaggcc
tcggaggcgctgggcgtgccctatgtctcgtcgaaggaggtgcggccggaggagctggtg
cgccgggtgggcgccgcggacgtcatctacgaggccgcgggcgtggcgaaggcggcgctg
gagacgctgaaggcgctggggcccaacggcgtctgcatcctcacgggcgtgccgtcccag
gaggagcccttcgacgtggccccggtgctcaagggcgtggtgctgggcaaccaggtgctg
ctgggcacggtgaacgcggcggacgtcgacttcgacatggcgctggaggacctgcgacac
ttccaggcgcgctggcccggacagttggagcggttcatctgctcgaagcacacgcccgag
gacttctgcgacgtcgtcaccggcaagaagtccggcggcatcaaggacgtcatccgcttc
atctga

DBGET integrated database retrieval system