KEGG   Myxococcus macrosporus: MYMAC_000184Help
Entry
MYMAC_000184      CDS       T05096                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00670  One carbon pool by folate
mmas01100  Metabolic pathways
mmas01120  Microbial metabolism in diverse environments
mmas01200  Carbon metabolism
Module
mmas_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MYMAC_000184
Enzymes [BR:mmas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     MYMAC_000184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ATB44613
UniProt: A0A250JLS9
Position
complement(217735..219390)
Genome map
AA seq 551 aa AA seqDB search
MTLRAMTDVGAELGLSPEDVLPWGTHRAKVSLDALGRRGGRQGRLVLVSAINPTPPGEGK
TTMSVSLAMGLRKRGRRAVAALREPSLGPVFGVKGGGTGGGQASLEPAADINLHFTGDLH
AITSANNLLSALVDNAVFYGQPVALDATRVRWRRAMDMNDRFLRNVIVGLGGKAQGVPRE
DHFDITAASEVMAILALAEGLKDLEARLGRVIIGHTRDGQPVRARDVDAAAAMVALLKDA
LMPNLAQTREGGPALVHAGPFANIAHGCSSVLGTRMGLAYADEVITEAGFGFDLGAEKFL
DIKCRGAGLWPRGVVLVVTLRALKHHGGAAPARVAEPDREALVRGFAHLEKHLESVAAFG
LPAVLCVNRFPQDTEAELEELRAFGRARGVELAVCDGYSRGGDGSLELADRVLEMLDGTD
AAPPQPRFLYDVAQSPEEKVAAIARTVYGADDVAFTSNAKKDLEAIRELGGAGLPVCMAK
THLSLSDDPTKPGRPRGFTLTVREVRLSAGAGFMVALTGDLLTMPGLPREPAARRVTVHD
DGRVTGLMQGE
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgagagccatgaccgacgtgggcgccgagctgggcctgtctcccgaggacgtg
ctgccgtggggaacccaccgggccaaggtgtcgctggacgcgctgggcagacgcggcggc
cggcaggggcggctggtgctggtgtccgccatcaaccccacgccgccgggcgagggcaag
acgaccatgtccgtgtcgctggccatgggcctgcgcaagcgcgggcgccgggcggtggcg
gccctgcgggagccgtcgctggggcccgtcttcggcgtgaagggcggcggcaccggcggc
gggcaggccagcctggagcccgcggcggacatcaacctgcacttcaccggggacctgcac
gccatcaccagcgccaacaacctgctgtccgcgctggtggacaacgccgtcttctacggg
cagccggtggccctggacgccacgcgcgtgcgctggcggcgcgccatggacatgaacgac
cgcttcctgcgcaacgtcatcgtcggcctgggcggcaaggcgcagggcgtgccgcgcgag
gaccacttcgacatcaccgccgccagcgaggtcatggccatcctcgcgctcgcggagggc
ctgaaggacctggaggcgcggctgggccgcgtcatcatcggacacacccgggacggccag
ccggtgcgcgcccgggacgtggacgcggcggcggccatggtggcgctgctcaaggacgcg
ctgatgcccaacctggcccagacgcgcgagggcggcccggcgctggtgcacgcggggccc
ttcgccaacatcgcccacgggtgcagctccgtgctgggcacgcgcatggggctggcctat
gcggacgaggtcatcacggaggcgggcttcggcttcgacctgggcgcggagaagttcctg
gacatcaagtgccgcggcgccgggctgtggccccggggcgtggtgctggtggtgacgctg
cgcgcgctgaagcaccacggcggcgccgcccccgcgcgcgtggccgagccggaccgcgag
gccctggtgcgcggcttcgcccacctggagaagcacctggagtcggtggccgccttcggc
ctgccggcggtgctgtgcgtcaaccgcttcccgcaggacaccgaggcggagctggaggag
ctgcgcgccttcggcagggcgcgcggcgtggagctggcggtgtgtgacggctactcgcgg
ggcggtgacggctcgctggagctggccgaccgcgtgctggagatgctggacggcacggac
gccgcgccgccccagccgcgcttcctctacgacgtggcgcagtcgcccgaggagaaggtg
gccgccatcgcccgcaccgtgtacggcgcggacgacgtggccttcacctcgaacgcgaag
aaggacctggaggccatccgcgagctgggcggcgcgggcctgccggtgtgcatggcgaag
acgcacctgtcgctgtcggatgaccccacgaagccggggcggccgcgcggcttcacgctc
accgtgagagaggtgcgcctgtccgcgggcgcgggcttcatggtggcgctcaccggcgac
ctcctcaccatgcccggcctgccgcgagagccggccgcccggcgcgtcaccgtccacgac
gacgggcgcgtcaccgggctgatgcagggggagtga

DBGET integrated database retrieval system