KEGG   Myxococcus macrosporus: MYMAC_003485Help
Entry
MYMAC_003485      CDS       T05096                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00230  Purine metabolism
mmas00240  Pyrimidine metabolism
mmas01100  Metabolic pathways
mmas01110  Biosynthesis of secondary metabolites
mmas01130  Biosynthesis of antibiotics
Module
mmas_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mmas_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mmas_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MYMAC_003485
   00240 Pyrimidine metabolism
    MYMAC_003485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmas04131]
    MYMAC_003485
Enzymes [BR:mmas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     MYMAC_003485
Membrane trafficking [BR:mmas04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    MYMAC_003485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ATB47866
UniProt: A0A250JXL2
Position
4167300..4167737
Genome map
AA seq 145 aa AA seqDB search
MAIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKSRPFF
KDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSD
SLENAKIEIAYFFRETEIHSYPYQK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgagcgtacgctgtccatcatcaagccggacggcctggagaagggcgtcatc
gggaagatcatcagccgcttcgaggagaaggggctgaagccggtcgccatccgcctgcag
cacctgtcccaggcgcaggccgagggcttctacgcggtccacaagtcccggcccttcttc
aaggacctggtgcagttcatgatctccggcccggtcgtcctcatggtgctggagggtgag
aacgccgtcctcgccaaccgggacatcatgggcgccaccaaccccgcgcaggcggccgag
ggcaccatccgcaaggacttcgccaccagcatcgacaagaacacggtgcacggctccgac
agcctggagaacgcgaagatcgagatcgcgtacttcttccgggagacggagatccactcc
tacccgtaccagaagtag

DBGET integrated database retrieval system