KEGG   Myxococcus macrosporus: MYMAC_004897Help
Entry
MYMAC_004897      CDS       T05096                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00900  Terpenoid backbone biosynthesis
mmas01110  Biosynthesis of secondary metabolites
mmas01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYMAC_004897
Enzymes [BR:mmas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     MYMAC_004897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ATB49255
UniProt: A0A250JZJ2
Position
complement(6175885..6177213)
Genome map
AA seq 442 aa AA seqDB search
MSDTVTSRLPGFHKLPMEERHAHLSRMFRLTPEDLQQLLGSEALQPVLANQMIENAVGTF
SLPLGLGLNLQVNGRDYLVPMAVEEPSVVAAVSFAAKIVREAGGFIGEADPSLMIGQVQV
SRYGDPTVATERILAHKEQILALANSFHPAMVARGGGAKDVEVRVLPAPEGPRGEPLLIV
HLIIDAQEAMGANLINTMAEGVAPLVEQVTGGKVYLRILSNLADRRLARAMCRIPIPLLA
DFEMPAEEIAEGIAQASRFAEADPYRAATHNKGVMNGIDAVAIATGQDWRAIEAGAHAFA
CRNGQYRPLSTWYLEEGHLVGRIELPMALGTVGGPIKIHPGVQMALKLMQTTTVRELAMV
IAAVGLAQNFAALRALGSVGIQKGHMAMHARCVAVTAGARGDWVEKIANLLVKAGHVKVE
KARELLAALPAEDAAAATGTNV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccgtgacgtcccggcttcccgggttccacaagctgccgatggaggagcgc
cacgcgcacctctcccgcatgttccggctcacgcccgaggacctgcagcagctcctgggc
tcggaggcgctccagcctgtcctggcgaaccagatgattgagaacgcggtggggaccttc
tccctgccgctgggcctggggctgaacctccaggtcaacgggcgcgactacctggtgccc
atggcggtggaggagccgtccgtggtggcggcggtgtccttcgcggcgaagatcgtccgg
gaggcgggcggcttcattggcgaggcggacccgtcgctgatgattggccaggtgcaggtg
tcgcgctacggcgacccgacggtggccaccgagcgcatcctggcgcacaaggagcagatc
ctcgcgctggccaacagcttccacccggcgatggtcgcgcggggcggtggggccaaggac
gtggaggtgcgcgtgctgccggcccccgagggcccgcgcggcgagccgctgctcatcgtc
cacctcatcatcgacgcccaggaggcgatgggggccaacctcatcaacaccatggcggag
ggcgtggcgccgctcgtcgagcaggtgacgggtggcaaggtgtatctgcgcatcctctcc
aacctggcggaccgccggctggcgcgggccatgtgccgcatccccatcccgctgctggcg
gacttcgagatgccggccgaggagatcgccgagggcatcgcccaggcgagccgcttcgcg
gaggccgacccgtaccgcgccgccacgcacaacaagggcgtgatgaacggcatcgacgcg
gtggccatcgccacggggcaggactggcgcgccattgaagcgggcgcgcacgcgttcgcc
tgccgcaacgggcagtaccggccgctgtccacctggtacctggaggaggggcacctggtg
ggccgcatcgagctgcccatggcgctgggcacggtgggcgggcccatcaagatccacccg
ggcgtgcagatggcgctcaagctgatgcagaccaccacggtgcgcgagctggccatggtg
atcgcggcggtgggtctggcgcagaacttcgcggcgctccgggcgctgggcagcgtgggc
atccagaagggccacatggcgatgcacgcgcgctgcgtggcggtgacggcgggcgcgcgg
ggcgactgggtggagaagatcgccaacctgctggtgaaggcgggccacgtgaaggtggag
aaggcccgcgaactgctggccgccctccccgccgaggatgccgcggccgcgaccggcacc
aacgtctga

DBGET integrated database retrieval system