KEGG   Myxococcus macrosporus: MYMAC_006208Help
Entry
MYMAC_006208      CDS       T05096                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00051  Fructose and mannose metabolism
mmas00520  Amino sugar and nucleotide sugar metabolism
mmas01100  Metabolic pathways
mmas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MYMAC_006208
   00520 Amino sugar and nucleotide sugar metabolism
    MYMAC_006208
Enzymes [BR:mmas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MYMAC_006208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer BAT
Motif
Other DBs
NCBI-ProteinID: ATB50552
UniProt: A0A250K4C5
Position
complement(7748364..7749428)
Genome map
AA seq 354 aa AA seqDB search
MALYPVIMAGGSGTRFWPLSRQARPKQFLPLASRLPLITDTSARLKGLASVKDTFIVCGP
LHAKAAAKLVKGLPRANLLVEPVARNTAPAIALAAVQVAARDPQGVMVVLPSDHHVADVP
GFKRTLADAADLAEAGHLVTLGIKPSRPETGYGYIQLGDALEGGGRKVRAFKEKPDLETA
RGYVSSGDYLWNGGIFVFRVDVILEAFAKHMPEMQKGLDALRKAAGKRTFGAVLKKVFPK
LPSTSIDYGVMEKASNIAVLPGDFGWSDVGSFAAIPEVRPADAHGNVVSGNLAVVVDCHN
CVVLADKRPLSVVGLTDMVVVDSGDAVLVVPKDKSQDVRKVVEALKARKLTKYL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccctctaccccgtcatcatggccggtggctccggcacccgcttctggccgctgtcc
cgtcaggcgcggcccaagcagttcctgccgctggcctccaggctgccgctcatcaccgac
acgtccgcgcgcctcaaggggctcgcctcggtgaaggacaccttcatcgtctgtggcccg
ctgcacgcgaaggccgcggcgaagctggtgaaggggctgcccagggcgaacctgctggtg
gagccggtggcccgcaacaccgcgcccgccatcgccctggcggcggtgcaggtggccgcc
agggacccccagggcgtcatggtggtgctgccctccgaccaccacgtggcggacgtgccc
ggcttcaagcgcacgctcgcggacgcggcggacctggcggaggcggggcacctcgtcacg
ctgggcatcaagccctcgcgcccggagacgggctacggctacatccagctcggcgacgcg
ctggagggcggcggacgcaaggtgcgggccttcaaggagaagcccgacctggagacggcg
cgcggctacgtgtcctccggggactacctgtggaacggcggcatcttcgtcttccgcgtg
gacgtcatcctggaggccttcgcgaagcacatgccggagatgcagaagggcctggacgcc
ctgcgcaaggccgcgggcaagcggaccttcggcgcggtgctgaagaaggtgttccccaag
ctgccctccacctccatcgactacggggtgatggagaaggcctccaacatcgcggtgctg
ccgggagacttcggctggtcggacgtgggctccttcgcggcgattccggaggtgcgcccc
gcggacgcccacggcaacgtggtgtccggcaacctggccgtggtggtggactgccacaac
tgcgtggtgctggcggacaagcggccgctgtccgtggtgggcctcaccgacatggtggtg
gtggactccggcgacgcggtgctggtggtgcccaaggacaagagccaggacgtgcgcaag
gtcgtggaggcgctcaaggcgcgcaagctgacgaagtacctgtag

DBGET integrated database retrieval system