KEGG   Methanosarcina mazei Tuc01: MmTuc01_0262Help
Entry
MmTuc01_0262      CDS       T02477                                 

Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase subunit H -like protein
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
mmaz00680  Methane metabolism
mmaz01100  Metabolic pathways
mmaz01120  Microbial metabolism in diverse environments
mmaz01200  Carbon metabolism
Module
mmaz_M00357  Methanogenesis, acetate => methane
mmaz_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MmTuc01_0262
Enzymes [BR:mmaz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MmTuc01_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrH
Motif
Other DBs
NCBI-ProteinID: AGF95711
UniProt: M1PU62
Position
282275..283207
Genome map
AA seq 310 aa AA seqDB search
MFKFQKEQEIANIAGIKVGGQPGELPTVLAGTIFYNRHEIVEDAAKGLFDRDAAEKLVNL
QESGSDTTGNPHMVHIFGTTAESITRYIDFIAEVSDSPFLIDSPEGPVRAHAAGYVSEIG
LADRAVYNSINMSINTSEMKALEQSDIDSSIILGFNAKDSSLQGRMEMLETGAGLLEEGL
LSIADRCGIVNKLIDPSITPMGNGAGIALRMTIAAKAKWGHPTGSGIHNAPSAWNWLNRQ
KEKDPVLYKICDIGSTCLQQAAAGDFILYGPIEYAEYVFPMAAMSDIMIAEAVADLDIEP
VERHPINFLV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagttccagaaagagcaggaaattgccaatattgcaggaataaaagtgggcgga
caacctggagaactccctaccgtacttgcagggaccatattttacaacaggcacgagatt
gtcgaagacgccgcaaaaggtctttttgacagggatgctgccgaaaaactcgtaaatcta
caggagtcgggttcggatactaccggaaaccctcatatggttcacatctttggcacaacc
gcagagagtatcacgcgttatattgattttattgcagaggtttcggattctccttttctc
atagattctcccgaagggcctgtacgtgcgcatgctgccggatacgtgagtgagatcggg
cttgcggacagggcagtatataactccataaatatgagcataaacacatcggaaatgaaa
gcccttgaacaatccgacatagacagttccattatcctgggcttcaatgccaaagactcc
tcccttcagggcagaatggaaatgctcgagacaggtgcaggactgttagaagaaggcctt
ctctcaattgcagataggtgcgggatagtaaacaaacttatagacccgagcataactccc
atgggaaacggagccggaatagccctcagaatgacgattgccgcaaaagcaaaatggggc
catcccacaggctcaggaatccataacgccccctcggcctggaattggctgaaccgccag
aaagaaaaagaccctgtcctgtataagatctgcgacataggctctacctgcctccagcag
gctgcagccggagatttcatcctctacggccctatagaatatgcagaatacgttttcccc
atggctgcaatgagtgatattatgattgccgaagccgtagccgaccttgatatagagcca
gtagaaaggcaccctattaactttctcgtttaa

DBGET integrated database retrieval system