KEGG   Methanosarcina mazei Tuc01: MmTuc01_1906Help
Entry
MmTuc01_1906      CDS       T02477                                 

Definition
(GenBank) Pyruvate carboxyl transferase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
mmaz00020  Citrate cycle (TCA cycle)
mmaz00620  Pyruvate metabolism
mmaz00720  Carbon fixation pathways in prokaryotes
mmaz01100  Metabolic pathways
mmaz01120  Microbial metabolism in diverse environments
mmaz01200  Carbon metabolism
mmaz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MmTuc01_1906
   00620 Pyruvate metabolism
    MmTuc01_1906
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmTuc01_1906
Enzymes [BR:mmaz01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MmTuc01_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N HlyD_D23 GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: AGF97245
UniProt: M1Q4J6
Position
1884178..1885899
Genome map
AA seq 573 aa AA seqDB search
MRVKITETVLRDAHQSLLATRMRTRDMLEVVEQLDQIGYFSLEMWGGATFDSCIRYLNED
PWQRLRDLKKNMDNTYAQMLLRGQNLVGYRHYSDDVVEKFVTKSYENGIDIFRVFDAVND
VRNMELSIKVAKRLGAHVQGTVCYTISPVHTVEKYVGLAKQLEELECDSLCIKDMAGLLS
PNEAAKIISAMKKEVSIPISLHCHCTSGMAPMSYMAACPAGVDVLDTALSPLAWGTSQPP
TETVVAALQGTPYDTGLDLGAFEEAVRYFKDLKEKYRGILDPISEQIDTNVLIYQIPGGM
LSNLVSQLKEQNALDKYGAVLQEMPKVREELGYPPLVTPTSQIVGTQAVLNVLMGERYKV
IPKEVKDYVRGLYGRSPAPISPEIIGKIIGDEEPIHCRPADLLKPEYEKRKKEAEEMGIA
NSEEDILTYILYPAIAPKFLKGEMEEEALAVITPAPATPQEYTIPTHFKVEVDDEVYDVR
VEPLGGGVSISEASPKKPSAESVKGGVTSSMQGMVLSLQVKVEDTVREGDTVAVIEAMKM
ENAVHAPRSGIVKEIFVAEGDTVAPGDIILSIE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtaaaaattactgaaaccgtcctccgggacgcacaccagtccctcctggcaacc
agaatgcggacaagggatatgctcgaagtggttgaacaactggaccagattgggtatttt
tccctcgagatgtggggaggtgccactttcgactcctgtattcgctatcttaacgaagac
ccctggcagcgcctcagggaccttaagaaaaatatggacaacacatatgctcagatgctt
ctccgcggccagaacctcgtaggatacaggcattattcggacgatgtggttgaaaagttc
gtaaccaagtcctatgaaaacggcattgatatattccgggtttttgacgctgtaaatgat
gtcaggaacatggagctgtccataaaagtggcaaaaaggctgggagctcatgtccagggc
actgtctgctacactataagtcctgtacatacagtagaaaagtatgtaggactcgcaaaa
cagcttgaagagctggaatgtgattcgctctgtatcaaagatatggcaggccttctttct
ccaaatgaagcggcaaaaataatcagtgccatgaaaaaagaggtttctatccctatttct
ctccactgtcactgtacttcgggaatggctcctatgagctatatggcagcctgccctgcc
ggagtggatgttctggatacggcactctcccctctggcatgggggacctcccagcctcct
accgagaccgttgttgcagctcttcagggaaccccctatgatacaggacttgaccttggg
gcttttgaagaggctgtcaggtacttcaaagacctgaaagaaaagtacagaggaatcctc
gatcctatttccgagcagattgacaccaatgttcttatctaccagatcccgggaggaatg
ctctccaatcttgtttctcagttgaaagagcagaatgccctcgataaatacggggcagtg
cttcaagagatgccaaaggtcagagaagagctcggttatcctcctcttgttactcccaca
agccagatcgtaggcacacaggctgtgctcaatgttctcatgggagaacgctacaaggtc
atcccgaaagaggtaaaggactacgtacgcggactctacggacgttctccagccccgatc
agccctgagatcataggaaagatcataggtgatgaagaaccgattcactgccgccctgca
gaccttctcaagcctgagtatgagaagagaaaaaaagaagcagaagaaatgggcattgca
aattctgaagaagatatccttacatacatactctatccggcaattgctcccaagttcctg
aaaggggaaatggaagaagaagccctggctgttatcacccctgccccggcgactcctcag
gaatacacaattcctacacacttcaaggttgaggtggacgatgaggtctacgacgtcagg
gtagagcctctcggcggcggagtttccatctctgaagcgtcccctaaaaagccaagtgca
gaatccgttaaaggaggggttaccagttcaatgcagggcatggtactttcccttcaggtt
aaagtagaagataccgtccgggaaggagacaccgtagctgttatcgaagccatgaagatg
gaaaatgcggttcatgccccacgctcgggaatagttaaggaaatctttgtagccgaaggg
gacaccgtcgcgcccggagatatcatcctttcaatcgagtaa

DBGET integrated database retrieval system