KEGG   Methanosarcina mazei Tuc01: MmTuc01_1945Help
Entry
MmTuc01_1945      CDS       T02477                                 

Definition
(GenBank) UbiX family decarboxylase associated with menaquinone via futalosine
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
mmaz00130  Ubiquinone and other terpenoid-quinone biosynthesis
mmaz00627  Aminobenzoate degradation
mmaz01100  Metabolic pathways
mmaz01110  Biosynthesis of secondary metabolites
mmaz01120  Microbial metabolism in diverse environments
mmaz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MmTuc01_1945
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MmTuc01_1945
Enzymes [BR:mmaz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     MmTuc01_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AGF97281
UniProt: M1PY81
Position
complement(1926292..1926876)
Genome map
AA seq 194 aa AA seqDB search
MEIIVGISGASGVQYGIRLLEVLANKGIKTHLVLTEAAKQIIEIETDFLPVEVEKLATWN
YSQKNFSAPIASGSYKTSGMIIAPCSMKTLGAVANGISDSLITRAADVCLKEERKLILMT
RETPLNLIHLENMLKARKAGASILPACPGFYSRPKTLDDIIDTMAGRALDLLGIENDIYQ
RWRQEKAEDLENNG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaaataattgtgggcatcagcggagcttccggggtccagtacgggatccgccttctt
gaagtgctggcaaataaagggattaaaacccatctcgtactgaccgaagctgcaaaacag
ataatcgagatcgagactgatttcctgcctgttgaagtggaaaaactggcaacctggaat
tattcccagaagaacttttcagctcctatagccagcggctcttacaaaacttcgggaatg
atcattgccccctgcagcatgaaaacccttggggcggttgcaaacgggatatctgattcc
ctgataacaagggctgcagatgtttgcctcaaagaggagagaaaactgatcctcatgaca
agagaaactcccctgaaccttatacaccttgagaacatgctgaaagccagaaaggcagga
gcaagcatccttcctgcatgcccgggattttattccagaccaaagactcttgatgacatt
atagacaccatggctggcagggctcttgacctcctgggaatagaaaatgacatttaccag
cgctggagacaggaaaaagccgaggatttggagaataacggctaa

DBGET integrated database retrieval system