KEGG   Methylotenera mobilis: Mmol_0045Help
Entry
Mmol_0045         CDS       T00942                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mmb  Methylotenera mobilis
Brite
Enzymes [BR:mmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mmol_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 MTS Methyltransf_18 Methyltransf_31 PrmA Methyltransf_11 Methyltransf_12 NodS Methyltransf_23 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ACT46956
UniProt: C6WY60
Position
48962..49651
Genome map
AA seq 229 aa AA seqDB search
MTQTAKAVESAQFNIGEARFNMIEQQIRTWEVLDPVVLAVLDAVPREKFVAESQVGLAFA
DVELPIGEGQTMLSPKLEGRILQALNIKKTDKVLLVGTGSGYLAALLATLAQHVHAVEIY
PTLSNAAQYRLQAQGIHNTTLYVADGVNGFAAAAPYDVIVFAGSLPLRPLAAEKMLNVGG
RLFAVVGESPIMEATVTERVGETSFRHETIFETCLPVLENAPQASKFAF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacagctaaagcagtagaaagtgctcaattcaacatcggtgaagctagattt
aacatgattgagcagcagattcgtacttgggaagtgttagaccctgtggtactagcggtg
ctagatgcagtgccacgtgagaagtttgttgcagagtctcaagtgggcttagcctttgca
gatgtggagctgcctatcggtgaaggccaaaccatgctgtcacctaagttggaaggacgc
attctgcaggcgctaaatattaaaaagaccgataaagtattgctagtgggtaccggtagc
ggctatctggctgcgttgctggctactttggcgcagcatgtacatgcggttgaaatttat
ccaacgctatctaatgcagcgcaataccgtttgcaggcgcagggcatccataacacgact
ttatacgtagctgatggtgtaaatggctttgcagctgccgcaccgtatgatgtgattgtg
tttgctggctctttgccgttgcgtccgttggcggcagaaaaaatgctcaatgttggcggc
aggttatttgctgtagtgggtgagtcgccaattatggaagcaaccgtgaccgagcgcgtg
ggcgaaacttccttccgccatgaaacgatttttgaaacctgcttgccagtgttggaaaat
gcgccacaagctagcaagtttgctttttaa

DBGET integrated database retrieval system