KEGG   Methylotenera mobilis: Mmol_0309Help
Entry
Mmol_0309         CDS       T00942                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00520  Amino sugar and nucleotide sugar metabolism
mmb00550  Peptidoglycan biosynthesis
mmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mmol_0309
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mmol_0309
Enzymes [BR:mmb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Mmol_0309
Peptidoglycan biosynthesis and degradation proteins [BR:mmb01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Mmol_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase GHMP_kinases_C SoxE
Motif
Other DBs
NCBI-ProteinID: ACT47219
UniProt: C6WSX7
Position
339140..340405
Genome map
AA seq 421 aa AA seqDB search
MDKLLITGGNRLHGEVVVSGAKNAALPILCASLLAETPLHLSSVPALKDVGSTIKLLEQM
GVKTERNADKVSLDASVVHTKEAPYEMVKTMRASILVLGPLLARFGHARVSLPGGCAIGS
RPVDLHIKGLQAMGAEIHIEHGYIEATTKHLPNQRLQGARYYMDLVTVTGTENLMMAAAL
ANGTTVLENAAKEPEVVDMAECLIKMGAKITGAGTDVITIEGVERLSGATHNVVCDRIEA
GTYMVAVAMTGGEVTLRNVQAHLLDAVIEKLREAGATVTSDADSITVKSDGQLKAVNIRT
APHPAFPTDMQAQFMALNTIASGVSKVTETIFENRFMHVQEMQRLGADIGIDGNTALVKG
VSFLDGATVMATDLRASASLVLAGLVARGDTVIERIYHLDRGYEHLEAKLNALGANVKRI
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttggacaaactgctgattacaggcggtaaccgccttcatggtgaagttgtcgtttctggt
gccaagaatgcggctttgcctattctgtgtgcatcgttactagccgaaacccctttacac
ttatctagcgtgcctgcccttaaagatgttggttcaaccattaagttgttggagcaaatg
ggggtgaagactgagcgcaacgcggataaagtgtcgctagatgctagcgttgtgcatact
aaagaagcgccgtatgaaatggtgaaaaccatgcgcgcatctatactggtattgggtcca
ctattagctcgctttggtcatgctcgtgtttcattgccgggtggctgtgctatcggctcg
cgtccagtggatttgcatatcaagggtttgcaggccatgggtgcggaaattcatatcgag
catggttacattgaggcaacaactaagcatctgccaaatcagcgtttgcaaggtgcgcgc
tactatatggatttggtgaccgttaccggcaccgaaaacctgatgatggcggcggcccta
gcgaacggtactacagtgttggagaatgctgccaaagagcctgaagtggttgatatggca
gagtgcttgattaaaatgggcgccaaaatcacgggtgccggtaccgatgtgattaccatt
gaaggtgtagagcgcttgtcaggcgcgacacataatgtggtgtgtgaccgtattgaggct
ggtacttatatggtagctgttgccatgactggtggagaggtgaccttgcgcaatgtgcag
gcacatctgctggatgcggtgattgagaaactgcgtgaggctggtgctaccgtgacatcg
gatgcagatagcattaccgtgaagagtgatggtcagttaaaggcggtaaacattcgtacc
gcaccgcatcccgcgtttccaaccgatatgcaggcgcagtttatggcgcttaacactatt
gcctccggcgtatctaaagtcacagaaaccatcttcgaaaatcgctttatgcatgtgcag
gaaatgcagcgtttgggcgcggatattggtattgatggcaataccgccttggttaaaggt
gtgtccttcttagatggcgctaccgtaatggcaactgacttacgcgcttctgcaagtttg
gtgttagccggcttggtggcccgtggcgatacggtgattgagcgtatctatcacttagac
cgcggttatgaacacttggaagctaagttaaacgccttgggcgccaacgtaaagcgaata
gcatag

DBGET integrated database retrieval system