KEGG   Methylotenera mobilis: Mmol_1149Help
Entry
Mmol_1149         CDS       T00942                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00020  Citrate cycle (TCA cycle)
mmb00620  Pyruvate metabolism
mmb01100  Metabolic pathways
mmb01120  Microbial metabolism in diverse environments
mmb01200  Carbon metabolism
mmb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmol_1149
   00620 Pyruvate metabolism
    Mmol_1149
Enzymes [BR:mmb01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Mmol_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_5 DUF1611_N Oxidored_nitro ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACT48055
UniProt: C6WVV6
Position
1243913..1245331
Genome map
AA seq 472 aa AA seqDB search
MFKKILVANRGEIAVRIVRACSEMGIKSVAIYTDADRQALHVKKADEAYHIGTDPVAGYL
NAHNIVNLAVAAGCDALHPGYGFLSENPELAEICERRGVKFIGPNADVIRQMGDKIQARN
AMTKAGIPCTPGSNGNLKDLEEAVALANKIGYPVMLKATNGGGGRGIRRCDSEKELLGNY
DRVISEASKAFGKPEVFIEKCVVSPRHIEVQVLADSQGNAIHLFERDCSIQRRNQKLIEI
APSPQLSQAQREYIGGLAVKAAKAVGYENAGTVEFLLDSDNTFYFMEMNTRLQVEHTVTE
TITGIDIVQEQIRVAYGLPLQYKQKDVSFRGYAMEFRINAEDPKNGFLPSFGKITRYYAP
GGPGVRMDAAIFSGYEIPPYYDSMCAKLTVWALTWEGVIERGRRALDDMIIYGVKTTIPY
YQEILKHQEFRDAEFNTSFVEMHPELANYANEIPPELIAAAISAVIAAHEGI
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaaaaaaattctagttgctaaccgcggtgaaattgcagtacgtattgtgcgcgca
tgctctgagatgggcatcaaatctgttgcaatctatacagatgcagaccgtcaggcttta
catgttaaaaaggcagatgaagcttatcatattggtacagaccctgtcgccggctattta
aatgcgcataatattgttaatttggcagtggctgcaggttgcgatgcactacaccctggc
tatggctttttgtctgaaaatccagagttggctgagatttgtgaacgtcgtggcgttaaa
tttatcggcccgaatgctgacgtgattcgtcaaatgggtgacaagattcaagcgcgtaat
gcgatgactaaagcaggcattccgtgcactcctggtagcaatggcaatttaaaggatttg
gaagaagccgtagcgcttgccaataaaattggctatccagtaatgctgaaagcaacgaat
ggtggcggtggccgcggtattcgtcgttgcgatagcgaaaaagagttattaggtaattat
gatcgcgtaattagtgaagcgagcaaggctttcggtaaacctgaagtgtttattgaaaag
tgcgttgtgtcaccgcggcatattgaagtgcaggtgttggctgactctcagggaaatgct
attcacctatttgagcgtgactgttcaattcagcgccgcaaccaaaaattaatcgaaatt
gccccctcacctcagctttcccaagcgcagcgtgaatatattggtgggctagcagtaaaa
gctgcgaaagcagttggctatgaaaatgcaggtaccgttgagttcctattggactctgac
aatactttctacttcatggaaatgaatacacgcttgcaagtggaacatacggtgacagaa
acaatcacaggtattgatattgtgcaggagcaaatccgtgtggcttatggcttgccttta
cagtacaagcaaaaagacgtgtcctttagaggttacgcgatggagttccgtatcaatgcg
gaagatcctaaaaatggattcttgccaagttttggtaaaattacacgttattacgcgccc
ggtggtccaggtgtgcgtatggatgctgcgatatttagtggctatgaaattccgccctac
tacgactctatgtgcgccaagttaacggtatgggcgctgacatgggaaggtgtgattgag
cgcggacgtcgcgcactggacgacatgattatttatggggtgaaaacgaccatcccttat
tatcaggaaattcttaagcatcaggagtttagggatgccgagtttaataccagctttgta
gagatgcatccagaattagcgaactacgctaatgaaattccgccagagctaatcgcagca
gcgatttcagcggtaattgcggcgcacgaaggtatttaa

DBGET integrated database retrieval system