KEGG   Mycobacterium sp. MCS: Mmcs_0263Help
Entry
Mmcs_0263         CDS       T00367                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00860  Porphyrin and chlorophyll metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
Module
mmc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmcs_0263
Enzymes [BR:mmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mmcs_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ABG06384
Position
complement(302767..303915)
Genome map
AA seq 382 aa AA seqDB search
MSEPDWAPLTGFRVAVTSARRAEELSALLRRRGATVTSAAAIAMVPLPDDDELRAHTQAL
IDAPPDIVIATTGIGLRGWIAAADGWGVAAELTAALAGARIVSRGPKATGALRAAGLPEE
WSPDSESSREVLRYLLDGGIADKRIAVQLHGATDDWDPFPEFLDELRAAGADVVPIRVYR
WRPAPRDGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRATEMGVADRVLTALRTNVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQARTVRVAGHLLEIRGTCVLV
DGVVKSLSPAGMATIRALAHRPGAVVSRTDLLGALPGSGTDTHAVETAVLRLRTALGDKQ
IVSTVVKRGYRLTVDDDLAEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcctgactgggcaccgctcaccggattccgggtggcggtgacctccgcccga
cgcgccgaggagctgagcgcactgctgcgccgccgcggcgccaccgtcaccagcgcggcc
gcgatcgcgatggtgccgctacccgacgacgacgaactgcgcgcccacacccaggcactg
atcgacgcaccgcctgacatcgtgatcgcgaccaccgggatcgggctgcgcggctggatc
gccgccgccgacggctggggcgtcgccgccgaactcaccgcggccctggcgggggcccgc
atcgtctcccgcggacccaaggcgaccggcgcgctccgggccgccggcctgcccgaggag
tggtcaccggattcggagtcgtcccgggaggtgctgcgctatctgctcgacggcggcatc
gccgacaagcgcatcgccgtccagttgcacggcgccaccgacgactgggaccccttcccc
gaattcctcgacgaactgcgggccgcgggcgccgacgtggtgccgatccgggtgtaccgc
tggcgtccggcaccccgcgacggcgacttcgaccagttggtggcgggcatcgccgaggag
aagttcgatgccgtcagcttcacctccgcaccggctgtggcgtcggtgctcatgcgggcc
accgagatgggtgtcgccgaccgggtgctgacggccctgcggaccaacgtgcacgcgatg
tgcgtcggcccggtcaccgcgcgtcccctggtccggctcggggttccgacgtcggcgccg
gagcgcatgcggttgggtgcgctggcccgccacatcaccgacgaactgccactgttgcag
gcccgcaccgttcgggtggccggacacctgctcgagatccgcggtacctgcgtactcgtg
gacggtgtggtcaaatcgctgtccccggccgggatggccaccatccgcgcactcgcgcac
cggcccggcgcggtggtgtcgcgcaccgacctgcttggcgcattgcccggcagcggcacc
gacacccacgctgtcgagaccgcggtgctgcggctgcgaaccgcgttgggcgacaagcag
atcgtctccacggtcgtcaaacgcggataccggctcaccgtcgacgacgatctggcggag
gccctgtga

DBGET integrated database retrieval system