KEGG   Mycobacterium sp. MCS: Mmcs_0357Help
Entry
Mmcs_0357         CDS       T00367                                 

Definition
(GenBank) 4-amino-5-aminomethyl-2-methylpyrimidine deaminase / thiaminase
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00730  Thiamine metabolism
mmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Mmcs_0357
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmc03000]
    Mmcs_0357
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     Mmcs_0357
Transcription factors [BR:mmc03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Mmcs_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ABG06478
Position
399087..399776
Genome map
AA seq 229 aa AA seqDB search
METPDESTTNTWSQRLWHETEPIFSAIMAHPFISGLTDGTLDPEVFAHYVAQDVHYLRDY
ARALAVVGAKAPRLADTAMFARHSAEIVEVELSLHETLLPEIGLDPAELDRVPVAPTTRA
YTSYLLATVYGGSFADGLAAILPCYWIYARVGEELIGRGSPDSRYQRWIDSYGGDEFAAT
VKEVLELTDRVGPTLKPAEEAAARAHYVTTARYEWMFFDAAHRREAWPV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcctgacgaatcgacgacgaacacctggtcgcagcggctgtggcacgagacc
gagccgatcttctcggcgatcatggcccacccgttcatctccgggctcaccgacggcacc
ctggaccccgaggtcttcgcgcactacgtcgcccaggacgtccactacctgcgcgactac
gcgcgggcgctcgcggtggtcggcgccaaggcgccgaggctggccgacaccgcgatgttc
gcccgccactcggccgagatcgtcgaggtggagctgtcgctgcacgagacgctgttaccc
gagatcgggctggacccggccgagctggaccgcgtaccggtggcccccaccacccgcgcc
tacaccagctatctgctcgcgacggtctacggcggcagcttcgccgacggcctggcggcg
atcctgccgtgctactggatctacgcgcgggtgggcgaggagttgatcggacggggatcg
cccgacagccgctaccaacggtggatcgacagctacgggggcgacgagttcgccgccacc
gtcaaagaggtgctcgagctcaccgaccgcgtcggcccgacgctgaagccggcggaggaa
gcggccgcccgcgcccactacgtgacgacggcacggtatgagtggatgttcttcgatgcg
gcgcaccgccgcgaggcctggccggtctga

DBGET integrated database retrieval system