KEGG   Mycobacterium sp. MCS: Mmcs_0636Help
Entry
Mmcs_0636         CDS       T00367                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00630  Glyoxylate and dicarboxylate metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mmcs_0636
Enzymes [BR:mmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mmcs_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABG06757
Position
699737..701023
Genome map
AA seq 428 aa AA seqDB search
MSTVGKPKSPEEIQKDWDTNPRWKGITRDYSPADVVALQGSVVEEQTLARRGAEVLWNQL
HDMEFVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALLRADEIARVEGDTSVENWLVPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTKEGFYRVKNGIEPCIARAKAYAPYSDLIWMETGTPDLELARKFAEG
VQAEFPDQMLAYNCSPSFNWKKHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMTAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttggcaagccgaagtcccccgaagagatccagaaggactgggacaccaac
ccccgctggaagggcatcacccgcgattactccccggcagacgtcgtggccctgcagggc
tcggtcgtcgaggagcagacgctggcccgccgcggcgccgaggtgctgtggaaccagctg
cacgacatggagttcgtgaacgcgctcggcgcgctgaccggcaacatggccgtccagcag
gtccgcgccggcctgaaggccatctacctgtcgggttggcaggtcgccggtgatgcgaac
ctgtccggccacacctaccccgaccagagcctgtacccggccaactcggtgccccaggtc
gtccgccggatcaacaacgcgctgctgcgcgccgacgagatcgccagggtcgagggcgac
acctcggtcgagaactggctcgtgccgatcgtcgccgacggtgaggccggattcggtggc
gcgctcaacgtctacgagctgcagaaggcgatgatcgccgccggtgtcgcgggttcgcac
tgggaggaccagctggcctcggagaagaagtgcggccacctcggtggcaaggtgctgatc
ccgacccagcagcacatccgcacgctgacctcggcccgcctggccgccgacgtcgccgac
gtgccgaccgtcgtcatcgcccgcaccgacgccgaggccgccaccctgatcacctccgac
gtcgacgagcgcgatcagccgttcatcaccggtgagcggaccaaggaaggcttctaccgc
gtcaagaacggcatcgagccgtgcatcgcgcgcgccaaggcctacgcgccgtactcggat
ctgatctggatggagaccggcaccccggacctggagctggcccgcaagttcgccgagggc
gtgcaggcggagttcccggaccagatgctggcctacaactgctcgccgtcgttcaactgg
aagaagcatctcgacgacgcgacgatcgcgaagttccagaaggaactcggtgcgatgggc
ttcaagttccagttcatcacgctggccggcttccacgccctgaactactcgatgttcgat
ctggcctacggctacgcccgcaaccagatgaccgcgtacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgcggttacaccgcgacgaagcaccagcgcgaggtcggcgccggc
tacttcgaccggatcgccaccaccgtcgacccgaccagctcgaccaccgcgctgaccggt
tccaccgaagagggccagttccactaa

DBGET integrated database retrieval system