KEGG   Mycobacterium sp. MCS: Mmcs_0659Help
Entry
Mmcs_0659         CDS       T00367                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00010  Glycolysis / Gluconeogenesis
mmc00260  Glycine, serine and threonine metabolism
mmc00680  Methane metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
mmc01230  Biosynthesis of amino acids
Module
mmc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmc_M00002  Glycolysis, core module involving three-carbon compounds
mmc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_0659
  Energy metabolism
   00680 Methane metabolism
    Mmcs_0659
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmcs_0659
Enzymes [BR:mmc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mmcs_0659
Membrane trafficking [BR:mmc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mmcs_0659
Exosome [BR:mmc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mmcs_0659
  Exosomal proteins of melanoma cells
   Mmcs_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABG06780
Position
720299..721045
Genome map
AA seq 248 aa AA seqDB search
MGDSTLILLRHGESEWNAKNLFTGWVDVDLTDKGRAEATRAGELIADLDRLPDVLYTSLL
RRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLNKAETKEKYGEEQFMAWRRSYD
TPPPPIEAGSEYSQDRDPRYADIDGGPLTECLADVVARFVPYFEQTIVPDLREGRTVLIA
AHGNSLRALVKYLDGMSDEDVVGLNIPTGIPLRYDLDSDLKPTVAGGTYLDPEAAAAGAA
AVASQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggagattccacgctgatcctgcttcgtcacggcgaaagtgaatggaacgcgaagaac
ctgttcaccgggtgggtcgacgtcgacctgaccgacaagggccgggccgaggccacgcgg
gcgggtgagctgatcgccgatctggaccggttgcccgacgtgctgtacacctcgctgctg
cggcgcgcgatcaccacggccaacatcgcgttggacaaggcggaccggcactggatcccg
gtgcaccgggactggcggctcaacgagcggcactacggggcgctgcaggggctgaacaag
gccgagaccaaagagaagtacggcgaggagcagttcatggcctggcggcgcagctacgac
accccgccgccgccgatcgaggccggcagcgagtacagccaggaccgcgatccgcgctac
gccgacatcgacggcggaccgctcaccgaatgcctggccgacgtggtggcccgcttcgtg
ccctacttcgagcagacgatcgtgccggatctgcgcgagggcaggaccgtgctgatcgcc
gcgcacggcaactcactgcgtgcgctggtcaagtacctcgacggcatgtccgacgaggac
gtggtcgggctgaacatcccgaccggcataccgctgcgctacgacctggactccgatctg
aagccgacggtggcaggcggcacgtacctcgatccggaggccgcggcggccggcgcggcg
gccgtggcatcccagggcgcgaagtaa

DBGET integrated database retrieval system