KEGG   Mycobacterium sp. MCS: Mmcs_1093Help
Entry
Mmcs_1093         CDS       T00367                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00010  Glycolysis / Gluconeogenesis
mmc00020  Citrate cycle (TCA cycle)
mmc00620  Pyruvate metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
Module
mmc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_1093
   00020 Citrate cycle (TCA cycle)
    Mmcs_1093
   00620 Pyruvate metabolism
    Mmcs_1093
Enzymes [BR:mmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mmcs_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23 RnfC_N Ribosomal_S7 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABG07206
Position
1192306..1193505
Genome map
AA seq 399 aa AA seqDB search
MTEFRMPALGSDMDEGTLDQWLVKPGDTVTRGQVVAVVETTKAAVEVECWQEGTVDRLLV
PEGQTVRVGTPLATLLAPGETPAPTAPAVPRTMRESPVAVERPEGAGRPAPAAGPAIATR
PHRRWVSPAARRVAATLDIDADTLTGTGPQGAVTIRDVEQAAASRKQPADGRTVRDRSVA
MRASIAAAMSRSKREIPHYYLADEVLMDPALAWLAERNAARSITERVLPAVLQIKAVAAA
ADRFPEFNGFWRDDAFVGADGVHVGVAISLRGGGLVAPAIHDVPDRSLDDLMGALTDLVA
RARAGSLRSSEMSDPSITITNLGDQGVDTVFGVIYPPQVALVGFGKPVQRVCAVDGGIRI
ATALTATLAADHRASDGHRGALFLAAINEILQQPQKLEK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagttccggatgcccgcgctcggctcggacatggacgaggggaccctcgaccaa
tggctggtcaaaccgggcgacaccgtcaccaggggccaggtcgtggcggtggtcgagacc
accaaggccgccgtcgaggtcgaatgctggcaggaggggaccgtcgaccgcctcctggtg
cccgaaggccagaccgtccgggtcggaacgccgctggccacgctgctggctccgggcgaa
acacccgcaccgactgcaccggcggtgcctcgcacgatgcgggaatcgccggtggccgtc
gagagaccagaaggcgcaggcaggcctgctccggccgcggggccagccatcgcgacccgg
ccgcatcgccggtgggtctccccggcggcccgccgcgtggcagcgacgctggacatcgac
gccgataccctcaccggcaccggtccgcagggcgcggtcaccattcgcgacgtggaacag
gcggcagcgtcgaggaagcagccggccgacgggcgaaccgtacgggatcggtccgtggcg
atgcgcgcgtcgatcgccgcggcgatgagccggtcgaagcgcgagattccgcactactac
ctggccgacgaagtcctcatggacccggcgctggcatggctggctgagcgcaacgccgcg
cgatccatcaccgaacgggtgttgccggcggtgctgcagatcaaggccgtcgcggcggca
gcggaccgctttcccgagttcaacggcttctggcgcgacgacgcgttcgtcggtgccgac
ggcgtccacgtcggtgtcgccatctcacttcgcggtgggggcctggtcgcacccgcgatc
cacgacgtccccgacaggagcctcgacgacctcatgggggccctgaccgacctggtggcg
cgcgcccgggccggctcgctgcgcagttcggagatgtctgatccctccatcacgatcacc
aacctgggcgaccagggggtggacacggtgttcggcgtcatctatccgccacaggtcgcc
ctggtgggcttcggcaagccggtgcaacgggtatgtgccgtcgacggtggtattcgtatc
gcgaccgcgctgaccgccactctggcagcggatcaccgggccagcgatggacaccgcggt
gcgctcttcctcgccgcgatcaacgagatcctgcagcagccgcagaagttggagaagtga

DBGET integrated database retrieval system