KEGG   Mycobacterium sp. MCS: Mmcs_1229Help
Entry
Mmcs_1229         CDS       T00367                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00020  Citrate cycle (TCA cycle)
mmc00190  Oxidative phosphorylation
mmc00650  Butanoate metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
Module
mmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmcs_1229
   00650 Butanoate metabolism
    Mmcs_1229
  Energy metabolism
   00190 Oxidative phosphorylation
    Mmcs_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABG07341
Position
complement(1328532..1329011)
Genome map
AA seq 159 aa AA seqDB search
MSPAENPYDHVTDRGGPAPVLQRSHDRPPSLDNPRAPKRAGGMPNFEKYAWLFMRFSGMV
LVFLALGHLFIMLMWDNGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGGNGLRVIIS
DYARKDSTRFWLNSLLALSMIFILVLGTYVLLTFDANIS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggcggagaacccctacgaccacgtcaccgaccgcggcggacccgcgccggtg
ctgcagcgcagccacgaccggccgccgagcctggacaacccgcgcgcacccaagcgtgcc
ggcggcatgccgaacttcgagaagtacgcatggctgttcatgcgcttctccgggatggtg
ctggtgttcctggcgctgggccacctgttcatcatgttgatgtgggacaacggcgtgtac
cgcatcgacttcaactacgtcgcgcagcggtggtcctcgccgttctggcagacctgggac
ctgctgctgctgtggctggcccagctgcacggcggcaacggcctgcgcgtgatcatctcg
gactacgcccgcaaggactccacgcggttctggctgaactcgctgctggcgctgtcgatg
atcttcatcctcgttctcggcacctacgtgctgttgacgttcgacgcgaacatctcgtaa

DBGET integrated database retrieval system