KEGG   Mycobacterium sp. MCS: Mmcs_1517Help
Entry
Mmcs_1517         CDS       T00367                                 

Definition
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00071  Fatty acid degradation
mmc00072  Synthesis and degradation of ketone bodies
mmc00280  Valine, leucine and isoleucine degradation
mmc00310  Lysine degradation
mmc00362  Benzoate degradation
mmc00380  Tryptophan metabolism
mmc00620  Pyruvate metabolism
mmc00630  Glyoxylate and dicarboxylate metabolism
mmc00640  Propanoate metabolism
mmc00650  Butanoate metabolism
mmc00900  Terpenoid backbone biosynthesis
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
mmc01212  Fatty acid metabolism
mmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmcs_1517
   00630 Glyoxylate and dicarboxylate metabolism
    Mmcs_1517
   00640 Propanoate metabolism
    Mmcs_1517
   00650 Butanoate metabolism
    Mmcs_1517
  Lipid metabolism
   00071 Fatty acid degradation
    Mmcs_1517
   00072 Synthesis and degradation of ketone bodies
    Mmcs_1517
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmcs_1517
   00310 Lysine degradation
    Mmcs_1517
   00380 Tryptophan metabolism
    Mmcs_1517
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mmcs_1517
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmcs_1517
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmcs_1517
Enzymes [BR:mmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mmcs_1517
Exosome [BR:mmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmcs_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABG07628
Position
complement(1651586..1652797)
Genome map
AA seq 403 aa AA seqDB search
MPEEAFIYEAIRTPRGKQRGGALHEVKPISLVVGLVDEIRSRFPDLDESLISDLILGVVS
PLGDQGAVLARTAVLAAKLPDTTGGVQLNRFCGSGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAWANDPETNYAVSFVPQGIGADLIATMEGFSREDVDAYAVRSQQRAAA
AWSGGYFAKSVVPVKDQNGLVILDHDEHMRPNTTLESLSKLKPAFTDIGAMGGFNEVALQ
KYHTVEKINHVHHGGNSSGIVDGAALVLIGSENAGVSQGLTPRARIVATATSGADGTIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLGIPDEKLNVNGGAIAMGHP
LGATGAMITGTMVDELERRGAKRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagaagccttcatctacgaagcgatccgcacgccgcgcggtaagcagcgcggt
ggcgctctgcacgaggtcaagccgatcagtctggttgtcggtctggttgacgagatccgc
tcgcgattccccgatttggatgagtccctgatctccgacctgatcctgggtgtggtgtcc
ccactgggcgatcagggcgctgtgcttgcccgcaccgcggtgctggcggccaagttgccc
gataccaccggcggcgtgcagctcaaccggttctgcggatcgggcctggaggccgtgaac
accgccgcgcagaaggtgcgctcgggctgggacgacctggtgctggccggtggcgtggag
tcgatgagccgcgtgccgatgggctccgacggcggcgcctgggccaacgacccggagacc
aactacgcggtgtcctttgtcccgcagggcatcggcgccgacctgatcgccaccatggag
ggcttctcgcgcgaggatgtcgacgcctacgcggtgcgcagccagcagcgtgccgcggca
gcatggtccggcggctacttcgccaaatcggttgtgccggtcaaggatcagaacggcttg
gtcatcctggatcacgacgagcacatgcgcccgaacaccaccctggagagcctgagcaag
ctcaagcccgcgttcaccgatatcggcgcgatgggcggcttcaacgaggtcgcgctgcag
aagtaccacacggtggagaagatcaaccacgtccaccacggtggtaacagttcgggcatc
gtcgacggcgccgccctggtgctgatcgggagcgagaacgccggtgtctcgcaggggctg
acgccgcgggcgcgcatcgtggcgacggccaccagcggcgccgacggcacgatcatgctg
acggggccgaccccggccacccgcaaggtgctcgaccgggccggtctgaccgtcgacgac
atcgacctgttcgaactgaacgaggccttcgcctcggtggtgctcaagttccagaaggac
ctgggcatccccgacgagaaactgaacgtcaacggtggcgccatcgcgatgggccacccc
ctgggcgccaccggcgccatgatcaccggaaccatggtcgacgagctcgagcgtcgcggc
gccaaacgcgcgctgatcacgctgtgcatcggcggcggcatgggcgtggccaccatcatc
gagcgcgtctag

DBGET integrated database retrieval system