KEGG   Mycobacterium sp. MCS: Mmcs_2406Help
Entry
Mmcs_2406         CDS       T00367                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00010  Glycolysis / Gluconeogenesis
mmc00051  Fructose and mannose metabolism
mmc00562  Inositol phosphate metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
mmc01230  Biosynthesis of amino acids
Module
mmc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmc_M00002  Glycolysis, core module involving three-carbon compounds
mmc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_2406
   00051 Fructose and mannose metabolism
    Mmcs_2406
   00562 Inositol phosphate metabolism
    Mmcs_2406
Enzymes [BR:mmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmcs_2406
Exosome [BR:mmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmcs_2406
  Exosomal proteins of bladder cancer cells
   Mmcs_2406
  Exosomal proteins of melanoma cells
   Mmcs_2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABG08514
UniProt: Q1B9C0
Position
2553864..2554649
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDLRSVQTLVDGD
KLRLSYGAQDVSQHDSGAYTGEISGAFLAKLGCSFAVVGHSERRTYHHEDDALVAAKAAA
AFRHGITPIVCIGEHLKVREAGNHVEHNVEQLRGSLAGLTSEQIGQAVIAYEPVWAIGTG
RVAGAADAQEVCKAIRDELGKLSSPQLAAGIRVLYGGSVNAKNVGEIVAQEDVDGALVGG
ASLDGEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaagccgctgatcgccggcaactggaagatgaacctcaaccacttcgaggcc
atcgcgctggtgcagaagatcgccttctcgctgccggacaagtacttcgacaaggtcgac
gtgacggtcatcccgccgttcaccgacctgcgcagcgtgcagacgctcgtcgacggggac
aaactgcgcctgagctacggcgcgcaggacgtttcgcagcacgattccggtgcctacacc
ggcgagatcagcggcgcgttcctggccaagctgggctgttcgttcgccgtcgtggggcac
tcggagcgccgcacctaccaccacgaggacgacgcgctggtggccgccaaggccgccgcg
gcgttccggcacggcatcaccccgatcgtctgcatcggtgagcacctgaaggtgcgtgag
gcgggcaaccacgtcgagcacaacgtcgagcagttgcgtggttcgctggcggggctgacg
tccgagcagatcggtcaggccgtcatcgcctacgaacccgtgtgggcgatcggcaccggc
cgggtggccggcgccgccgacgcgcaggaggtgtgcaaggccatccgcgacgagctcggg
aagctctcctcaccgcagctggcggccgggatcagggtgctctacggcgggtcggtgaac
gccaagaacgtcggggagatcgtggcccaggaagacgtcgacggtgcgctggtcggtggg
gcctccctggacggtgagcagttcgccacgctgtcggcgatcgccgccggcgggcccctg
ccctga

DBGET integrated database retrieval system