KEGG   Mycobacterium sp. MCS: Mmcs_2806Help
Entry
Mmcs_2806         CDS       T00367                                 

Definition
(GenBank) urease, beta subunit
  KO
K01429  urease subunit beta [EC:3.5.1.5]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00220  Arginine biosynthesis
mmc00230  Purine metabolism
mmc00791  Atrazine degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mmcs_2806
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Mmcs_2806
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    Mmcs_2806
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     Mmcs_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_beta
Motif
Other DBs
NCBI-ProteinID: ABG08913
UniProt: Q1B871
Position
complement(2953253..2953570)
Genome map
AA seq 105 aa AA seqDB search
MVPGEIFFGEGDVEINAGARRLEMEIVNTGDRPVQVGSHVHLPQANAALDFDRTAARGHR
LDVPAGTAVRFEPGVAQRVRLVPLGGSREVHGLSLNPPGRLDGAS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggtgagatcttcttcggcgaaggggatgtcgagatcaacgccggtgcccga
cgcctggagatggagatcgtcaacaccggtgaccggccggtgcaggtcggcagccatgtc
cacctgccgcaggccaacgccgcactcgacttcgaccgcaccgccgcccgcggccaccgc
ctcgacgtcccggccggcaccgcggtgcgcttcgaacccggtgtggcccagcgcgtccgg
ctcgtgccgctgggaggcagtcgtgaggtgcacggcctgtcgctgaacccacccggcaga
ttggacggggcgtcgtga

DBGET integrated database retrieval system