KEGG   Mycobacterium sp. MCS: Mmcs_3342Help
Entry
Mmcs_3342         CDS       T00367                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00860  Porphyrin and chlorophyll metabolism
mmc01100  Metabolic pathways
mmc03030  DNA replication
Module
mmc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmcs_3342
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Mmcs_3342
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmc03032]
    Mmcs_3342
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Mmcs_3342
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     Mmcs_3342
DNA replication proteins [BR:mmc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     Mmcs_3342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: ABG09449
Position
complement(3542028..3543125)
Genome map
AA seq 365 aa AA seqDB search
MKVLVEADGGSRGNPGPAGYGSVVWSEDRSSVLAEAKQSIGRATNNVAEYRGLIAGLEEA
ANVGATEVAVSMDSKLIVEQMAGRWRVKHPDLIPLYQRARELAEGFDRVTYSWIPRAANA
RADRLANEAMDAAQGIDPPPRTAAPAASTHTPTSPAGWTGARGEPTRFLLLRHGQTELSV
ERRYSGRGNPALTELGRSQAGAAAAYLAGRGGIDAVITSPLQRAYDTATAAAKTLGLDVT
VDEDLIETDFGAWEGLTFGEASQRDPELHGRWLRDTSVDPPGGESFDTVAHRVRRARNRI
IADHGASTVLVVSHVTPIKTMLRLALNAGEGILYRLHLDLASLSIAEFYPDGGSSVRLVN
QTAHL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggttctcgtcgaggccgacggcggctcgcggggcaaccccggaccggcgggctac
ggctcggtggtctggtcggaggaccggtcgtcggtgctcgccgaggccaaacagtcgatc
ggccgggccaccaacaacgtcgccgagtaccgcgggttgatcgccggtctcgaggaggcc
gccaacgtcggcgccaccgaggtcgcggtgtcgatggactccaaactcatcgtcgagcag
atggcgggccgctggcgggtcaaacaccccgacctgattccgctgtatcagcgggcgcgg
gaactggccgaggggttcgaccgcgtcacgtattcgtggattccgcgggccgccaacgcc
cgcgccgaccggctggccaacgaggcgatggacgccgcgcagggtatcgaccccccgccg
cgcacggccgcccccgccgcgtccacccacacccccacgtcaccggccggctggacgggt
gcgcggggggagccgacacggttcctgctgctgcgccacggacagaccgagctgtcggtg
gagcgccggtactccgggcgcggcaacccggcgctgaccgaactgggccgcagccaggcc
ggcgccgcggccgcctacctcgcgggtcggggcggcatcgacgccgtcatcacctcaccg
ctgcagcgcgcctacgacaccgcgaccgctgccgccaagacgctcggactggacgtcacc
gtcgacgaggatctgatcgagacggatttcggcgcctgggaagggctgacattcggcgaa
gcgtcgcaacgggatccggagctgcacggccgctggctgcgcgacaccagcgtcgacccg
cccggcggggagagcttcgacaccgtcgcccaccgggtgcggcgggcccgcaaccgcatc
atcgccgaccacggcgcctcgacggtgctggtggtctcccacgtcacgccgatcaagacg
atgctgcggctggcgctcaacgccggggaaggcatcctgtaccggctgcacctggatctc
gcctcgctgagcatcgcggagttctaccccgacggtggatcgtcggtgcggctggtcaac
cagaccgcccacctctag

DBGET integrated database retrieval system