KEGG   Mycobacterium sp. MCS: Mmcs_4121Help
Entry
Mmcs_4121         CDS       T00367                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00010  Glycolysis / Gluconeogenesis
mmc00030  Pentose phosphate pathway
mmc00051  Fructose and mannose metabolism
mmc00680  Methane metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
Module
mmc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_4121
   00030 Pentose phosphate pathway
    Mmcs_4121
   00051 Fructose and mannose metabolism
    Mmcs_4121
  09102 Energy metabolism
   00680 Methane metabolism
    Mmcs_4121
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mmcs_4121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ABG10226
Position
4386307..4387368
Genome map
AA seq 353 aa AA seqDB search
MPADPDALRASGSSRRREAPDRNLALELVRVTEAGAMAAGRWVGRGDKEGGDGAAVDAMR
ELVNSVSMRGVVVIGEGEKDNAPMLYNGEEVGNGDGPDCDFAVDPIDGTTLMSKGMPNAI
SVLAVAERGAMFDPSAVFYMNKIAVGPDAVDAIDITAPIGENVRAVAKVKGLSVRDVTVC
ILDRPRHEQLIADVRDSGARIRLISDGDVAGAISACRPNSGTDMLAGIGGTPEGIITAAA
IRCMGGAIHAQLAPKDDEERQKAIDAGHDIDRVLKTEDLVSGENVFFCATGVTDGDLLQG
VRYTGGGCTTQSIVMRSKSGTVRMIEAYHRLSKLNEYSAVDFTGDSNAAYPLP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgaccctgatgctcttcgcgcaagcggctcatcgcgccgcagagaagccccc
gaccgcaacctcgccctcgaactcgtccgcgtcaccgaggccggcgccatggcggcgggc
cgctgggtagggcgcggggacaaggagggcggcgacggcgcagcggtcgacgccatgcgc
gaactggtcaactcggtgtcgatgcgcggcgtcgtggtgatcggcgagggcgagaaggac
aacgcgccgatgctctacaacggcgaggaggtcggcaacggcgacgggcccgactgcgac
ttcgccgtcgaccccatcgacggcaccacgctgatgagcaagggcatgccgaacgcgatc
tcggtgctcgccgtggccgagcgcggcgcgatgttcgacccgtcggcggtgttctacatg
aacaagatcgccgtcggtccggacgccgtcgacgccatcgacatcaccgcgccgatcggc
gagaacgtgcgcgccgtggccaaggtcaaggggctgtcggtgcgcgacgtgacggtctgc
atcctcgaccggccgcgtcacgaacagctcatcgccgacgtccgcgactccggcgcccgc
atccggctgatctccgacggtgacgtcgcgggcgcgatctcggcgtgccggccgaattcg
ggtaccgacatgctggccggtatcggtggcacccccgagggcatcatcaccgccgccgcc
atccgctgtatgggcggcgccatccacgcccagctcgcccccaaggacgacgaggagcgc
cagaaggccatcgacgccggccacgacatcgaccgcgtgctcaagaccgaggatctggtg
tcgggcgagaacgtgttcttctgcgcgaccggcgtcaccgacggcgacctgctgcagggc
gtgcgctacaccggcggcgggtgcaccacccagtcgatcgtgatgcggtcgaagtccggc
acggtccgcatgatcgaggcctaccaccggctgtccaagctcaacgagtactccgctgtc
gacttcaccggcgacagcaacgccgcctatcccctgccgtaa

DBGET integrated database retrieval system