KEGG   Mycobacterium sp. MCS: Mmcs_4156Help
Entry
Mmcs_4156         CDS       T00367                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00071  Fatty acid degradation
mmc00280  Valine, leucine and isoleucine degradation
mmc00281  Geraniol degradation
mmc00310  Lysine degradation
mmc00360  Phenylalanine metabolism
mmc00362  Benzoate degradation
mmc00380  Tryptophan metabolism
mmc00410  beta-Alanine metabolism
mmc00627  Aminobenzoate degradation
mmc00640  Propanoate metabolism
mmc00650  Butanoate metabolism
mmc00903  Limonene and pinene degradation
mmc00930  Caprolactam degradation
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01212  Fatty acid metabolism
Module
mmc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mmcs_4156
   00650 Butanoate metabolism
    Mmcs_4156
  Lipid metabolism
   00071 Fatty acid degradation
    Mmcs_4156
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmcs_4156
   00310 Lysine degradation
    Mmcs_4156
   00360 Phenylalanine metabolism
    Mmcs_4156
   00380 Tryptophan metabolism
    Mmcs_4156
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmcs_4156
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mmcs_4156
   00281 Geraniol degradation
    Mmcs_4156
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmcs_4156
   00627 Aminobenzoate degradation
    Mmcs_4156
   00930 Caprolactam degradation
    Mmcs_4156
Enzymes [BR:mmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mmcs_4156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABG10261
Position
4422583..4423356
Genome map
AA seq 257 aa AA seqDB search
MDYETILVTREGRVGTITLNRPKALNALNSQVMAEVTTAAAEFDSDEGIGAIVVTGSEKA
FAAGADIKEMASLSFAEVFTSDFFALWGKFAATRTPTIAAVAGYALGGGCELAMMCDILI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTIGAEEAERSGLVSRVV
PADRLLDEANEVAATIAGMSRNASRMAKEAVDRAFESTLTEGLLYERRLFHSTFATEDQK
EGMAAFSEKRPANFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggactacgagaccatcctcgtcacccgcgagggccgggtcggcacgatcacgctgaac
cgccccaaggcgctcaatgcgctcaactcgcaggtgatggccgaagtcaccacagcggca
gccgaattcgactccgacgagggtatcggcgcgatcgtcgtcaccggcagcgagaaggcc
ttcgcggcgggcgccgacatcaaggagatggcgagcctgtcgttcgccgaggtgttcacc
tcggacttcttcgcgctgtggggcaaattcgccgccacccgcaccccgaccatcgccgcc
gtggcgggttacgccctgggcggcggatgcgagctggcgatgatgtgcgacatcctcatc
gccgccgacaccgcgaagttcggccagcccgagatcaagctgggcgtgctgcccggcatg
ggcggatcgcagcggctgacccgcgcgatcggcaaggccaaggcgatggacctgatcctg
accggccgcacgatcggcgccgaggaggccgagcgcagcggtctggtgtcacgggtggtg
cccgccgaccgactgctcgacgaggccaacgaggtggccgcgacgatcgcggggatgtcg
cgcaacgcatcccggatggccaaggaagcggtcgaccgtgccttcgagtccacgctgacc
gagggcctgctctacgaacgccggctcttccactccaccttcgcgaccgaggatcagaag
gaaggtatggcggcgttcagcgagaagcgcccggccaacttcacgcatcgctag

DBGET integrated database retrieval system