KEGG   Mycobacterium sp. MCS: Mmcs_4314Help
Entry
Mmcs_4314         CDS       T00367                                 

Definition
(GenBank) putative magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00860  Porphyrin and chlorophyll metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmcs_4314
Enzymes [BR:mmc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mmcs_4314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_PrkA AAA_3 MCM ABC_tran AAA_16 NACHT AAA_22 DLIC
Motif
Other DBs
NCBI-ProteinID: ABG10419
Position
complement(4584687..4586072)
Genome map
AA seq 461 aa AA seqDB search
MVTQPHDLPRTVGELRASGHRERGVKQEIQENLLAGLAEGRDMWPGILGFEDTVIPQLER
ALIAGHDIVLLGERGQGKTRLLRALTGLLDEWTPVIEGSELGEHPYTPITPESIRRVADS
GDDLKVAWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRAHR
GIVAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIIT
PLKDRFGAEIRTHYPLQLDAEVGVITQEAQLAAAVPDHLLQILARFARNLRESSSVDQRS
GVSARFAIAAAETVAAAARHRSTILGEQEPVARVVDLGTVVDVLRGKLEFESGEEGREQV
VLEHLLRRATADTAQRLLGGLDVGPLVAAVEEGSPVTTGERVSAKDVLAALPDLPVIDAI
ATRLGAQTDGERAAAVELALEALYLAKRIDKVSGEGETVYG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacccaaccccatgatctgccccggaccgtcggcgaactacgcgcctccggccat
cgcgagcggggcgtcaaacaggaaatccaggagaacctgctggccggattggccgagggc
cgcgacatgtggcccgggatcctgggtttcgaggacacggtgatcccgcaactcgagcgg
gctttgatcgccggacacgacatcgtgctgctcggtgagcgcggccagggcaagacccgg
ctgctgcgcgcgctgaccggactgctcgacgagtggacacccgtcatcgaggggtcggaa
ctgggcgagcacccgtacaccccgatcacccccgaatccatccggcgggttgccgattcg
ggcgacgacctgaaggtggcctggcgccaccgcagcgagcggtacaccgagaaactcgcc
accccggacaccagcgtggccgacctggtcggcgacatcgacccgatcaaggtggccgag
ggccgcagcctcggcgacccggagaccatcgcctacggcctgatcccccgcgcacaccgc
ggcatcgtcgcggtcaacgagctgcccgacctcgccgagcgcatccaggtgtcgatgctc
aacgtgatggaggagcgcgacatccaggtccgcggctacacgctgcggctgccgctcgac
gtcctcgtcgtcgccagcgcgaacccggaggactacaccaaccgcggtcgcatcatcacc
ccgctcaaggaccggttcggcgccgagatccgcacgcactatccgctgcagctcgacgcg
gaggtcggcgtcatcacccaggaggcgcagctcgcggcggccgtccccgaccacctgctg
cagatcctcgcccgcttcgcccgcaacctgcgcgaatcgagttcggtggatcagcgttcg
ggcgtctccgcgcggttcgcgatcgccgcggccgagaccgtcgccgcggccgcccggcac
cgctcgacgatcctcggggagcaggagccggtcgcccgcgtggtcgacctcggcaccgtc
gtcgacgtgctgcgcggcaagctcgagttcgaatccggtgaagaggggcgtgagcaggtg
gtgctcgagcacctgctgcgccgcgccaccgccgacaccgcgcagcggttgctcggtggt
ctcgacgtcgggccgctcgtcgcggcggtcgaggagggttccccggtgacgacgggtgaa
cgtgtgtccgccaaggacgtgctggccgcgctgccggacctgccggtgatcgacgcgatc
gccacccggctgggcgcgcagaccgacggtgaacgcgccgccgccgtcgaactggcgctc
gaggcgctgtacctggccaagcggatcgacaaggtctccggagagggcgaaaccgtctat
ggctga

DBGET integrated database retrieval system