KEGG   Mycobacterium sp. MCS: Mmcs_4327Help
Entry
Mmcs_4327         CDS       T00367                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00020  Citrate cycle (TCA cycle)
mmc00640  Propanoate metabolism
mmc00660  C5-Branched dibasic acid metabolism
mmc01100  Metabolic pathways
mmc01110  Biosynthesis of secondary metabolites
mmc01120  Microbial metabolism in diverse environments
mmc01130  Biosynthesis of antibiotics
mmc01200  Carbon metabolism
Module
mmc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmcs_4327
   00640 Propanoate metabolism
    Mmcs_4327
   00660 C5-Branched dibasic acid metabolism
    Mmcs_4327
Enzymes [BR:mmc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mmcs_4327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABG10432
UniProt: Q1B3V2
Position
complement(4600835..4601998)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEDAKAIAEEIGKPVMVKAQVKVGGRGKAGGVK
YAATADDAFTHAQNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGVEIEEVAATKPDRLARIPVDATKGVDEAFAREIAEKGHLPAEVLDAAAVTIAKLWEVF
VGEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRHPEHAEFEDRDATDPLELKAKEN
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHNGVKPANFLDIGGGASAEVMANGLD
VILNDSQVKSVFVNVFGGITACDAVANGIVKALEILGEEANKPLVVRLDGNRVEEGRKIL
ADANHPLVVLAQTMDEGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaccttttcgagtaccaggcgaaggagctgttcgccaagcacaacgtcccgaccacg
cctggccgggtgaccgacaccgccgaagacgccaaggcgatcgccgaggagatcggcaag
cccgtgatggtcaaggcccaggtcaaggtcggcggccgcggtaaggccggtggcgtgaag
tacgccgccaccgcagacgacgccttcacccacgcgcagaacatcctcggcctcgacatc
aagggccatgtcgtgaagaagctcctggtcgccgaggccagcgacatcgcggaggagtac
tacatctccttcctcctcgaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggcgtggagatcgaagaggtcgccgccaccaagcccgaccgcctggcccgcatcccc
gtcgacgccaccaagggtgtcgacgaggccttcgcgcgcgagatcgccgagaagggccac
ctgcccgccgaggtgctcgacgccgccgcggtgaccatcgccaagctgtgggaggtgttc
gtcggcgaggacgccacgctggtggaggtcaacccgctggtgcgcacgcccgacgatcag
atcctggcgctcgacggcaaggtcaccctcgacgcgaacgccgacttccgtcatccggag
cacgccgagttcgaggaccgcgatgcgaccgatccgctggagctcaaggccaaggagaac
gacctcaactacgtcaaactcgacgggcaggtcggcatcatcggcaacggcgcgggcctg
gtcatgtcgacgctcgatgtggtcgcctacgcgggtgagaagcacaacggcgtcaagccg
gccaacttcctcgacatcggcggcggcgcctcggccgaggtgatggccaacggtctggac
gtcatcctgaacgacagccaggtcaagagtgtgttcgtcaacgtcttcggcggcatcacg
gcgtgcgatgccgtcgccaacggcatcgtcaaggcgctcgagatcctcggcgaggaagcc
aacaagccgctcgtagtgcgcctcgacggcaaccgcgtcgaggagggtcgcaagatcctc
gccgacgccaaccacccgctggtggtgctggcgcagaccatggacgagggcgccgacaag
gccgccgagttggcgaacaagtaa

DBGET integrated database retrieval system