KEGG   Mycobacterium sp. MCS: Mmcs_4362Help
Entry
Mmcs_4362         CDS       T00367                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    Mmcs_4362
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     Mmcs_4362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N Phosphatase Shikimate_DH HATPase_c_2 NAD_binding_3 Lambda_CIII F420_oxidored ApbA Epimerase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ABG10467
Position
4642911..4643702
Genome map
AA seq 263 aa AA seqDB search
MILDRFRLDGQVATVTGAGRGLGAAIAVAFAEAGADVVIAARTESQLDEVAERIRATGRR
AHVVVADLAHPESTAGLAPAAVEAFGKLDIVVNNVGGTMPAALTDTSAKDLKDAFTFNVA
TAHALTTAAVPLMLEHSGGGSVINITSTMGRLAGRGFAAYGTAKAALAHYTRLAALDLCP
RIRVNAIAPGSILTSALDIVASNDDLREPMEKATPMRRLGDPEDIAAAAVYLASPAASYL
TGKTLEVDGGLTFPNLDMPFPDL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctggacagattccggctcgacggacaggtcgccaccgtcaccggcgcgggccga
ggactgggcgccgccatcgcggtggcgttcgcggaagccggtgcggacgtggtgatcgcg
gcccgcaccgaatcgcaactcgacgaggtcgccgagcggatccgggcgaccggacggcgc
gcccacgtcgtcgtcgccgacctcgcccaccccgagtcgacggccgggctcgcaccggcc
gcggtggaggccttcggaaaactagacatcgtcgtcaacaacgtcggcggcaccatgccg
gccgccctgaccgacacctccgcgaaggatctcaaggacgcgttcaccttcaacgtcgcc
accgcccacgcgctgaccacggccgcggttccgttgatgctcgagcactccggcggcggc
agcgtcatcaacatcacctcgacgatgggccgcctcgccggccgcggcttcgccgcctac
ggcaccgcgaaagccgcgctcgcgcactacacccggctcgccgcgctcgacctctgcccg
cggatccgggtcaacgcgatcgcgcccggttccatcctcacctccgcgctcgacatcgtc
gccagcaacgacgaccttcgcgagcccatggagaaggcgacgccgatgcgccggctcggc
gatcccgaggacatcgccgccgctgcggtctacctggcctcgccggcggcgagctacctg
accggtaagaccctcgaggtcgacggcgggctgacgttccccaacctcgacatgcccttc
ccggacctctag

DBGET integrated database retrieval system