KEGG   Mycobacterium sp. MCS: Mmcs_4880Help
Entry
Mmcs_4880         CDS       T00367                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00340  Histidine metabolism
mmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Mmcs_4880
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     Mmcs_4880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: ABG10984
Position
complement(5169951..5170658)
Genome map
AA seq 235 aa AA seqDB search
MCRHLGWLGAPRSVSALILDPPYGLLVQSYAPRRQKHGLMNADGWGVGFFSSDLPDDAAP
CRWRSAAPLWGDASFASVAPALRSACVVGAVRSASIGMPIEPTASAPFTDGSWLLSHNGL
VDRAVLPLSAHAESTVDSALLAALIFDRGMDRLGDTVTEVGARDPGARLNILAANGSQMV
ATTWGDTLSVLRTDDGVALASEPYDDDPRWEEIPDRHLVRTDGSSVQLSALRGPA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgccacctcggctggttgggggcgccgcgctcggtcagcgcgctcatcctcgac
ccgccctacggcctgctggtgcagtcctacgcgccgcgccgccagaagcacgggctgatg
aacgccgacggatggggggtcggcttcttctcatcggaccttcccgacgatgcggccccc
tgccggtggcgcagcgccgccccgctgtggggggacgcgtcgttcgcgtcggtcgccccc
gcgctgcgcagcgcgtgcgtggtcggggcggtccggtcggccagtatcggcatgccgatc
gagccgaccgcctcggcgccgttcaccgacgggtcgtggctgctgtcgcacaacgggctc
gtcgaccgggcggtgctgccgctgtccgcgcacgccgaatcgaccgtcgacagtgcgctg
ctcgccgcgctgatcttcgaccggggcatggaccggctcggcgacaccgtcaccgaggtg
ggagcccgcgaccccggcgcacggctgaacatcctggccgccaacggatcccagatggtc
gccaccacctggggggacacgttgtcggtgctgcgcaccgacgacggcgtggcgttggcc
agcgaaccctacgacgacgacccgcgctgggaggagatcccggaccgccacctggtccgc
acggacggctcctcggtacagctgagcgcgctgagaggaccggcatga

DBGET integrated database retrieval system