KEGG   Mycobacterium sp. MCS: Mmcs_5438Help
Entry
Mmcs_5438         CDS       T00367                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00360  Phenylalanine metabolism
mmc00362  Benzoate degradation
mmc00621  Dioxin degradation
mmc00622  Xylene degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Module
mmc_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mmcs_5438
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmcs_5438
   00622 Xylene degradation
    Mmcs_5438
   00621 Dioxin degradation
    Mmcs_5438
Enzymes [BR:mmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Mmcs_5438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm Aldolase
Motif
Other DBs
NCBI-ProteinID: ABG11538
UniProt: Q1B0P6
Position
Plasmid1:19193..20242
Genome map
AA seq 349 aa AA seqDB search
MTETVSRPHATEGAALYIQDVTLRDGMHAMRHRISPEKVAAIAGALDTAGVDAIEVTHGD
GLAGHSLTYGPGSNTDWEWIEAAADVVHRAKLTTLLLPGVGTVRELEHAYKLGVTSVRVA
THCTEADVSAQHIGTARELGMDVSGFLMMSHLAEPSHLAAQAKLMESYGAHCVYVTDSGG
RLTMGSVRDRVRAYRDVLDAGTQIGIHAHQNLSLSVANTVVAVEEGVTRVDASLAGHGAG
AGNCPIEPFIAVADLHGWKHNCDLFGLQDAADDIVRPLQDRPVQVDRETLTLGYAGVYSS
FLRHAEAAAKQYGLDTRAILLAVGERGLVGGQEDLIPDIALDLQQNLRR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacggttagccggccccatgcgactgagggtgcggcgctctacattcaggac
gtcacactgcgcgatggtatgcatgccatgcgccaccggatcagtccggagaaggtcgcg
gcgatcgcaggcgcactcgacactgccggagtcgacgccatcgaagtcacccacggtgac
ggcctggccgggcacagcctgacctacggtcccgggagcaacaccgactgggaatggatc
gaagcggccgcagacgtcgtacaccgcgccaaactcacgactctgctgttgcctggggtc
gggacggtccgcgaactcgagcacgcctacaaactgggggtgacctcggtccgggtcgca
acgcactgcaccgaggccgatgtctcggcacagcacatcggaacggcccgcgaactgggc
atggatgtttccgggtttctgatgatgtcgcacctcgccgaaccctcacatctggctgcc
caggccaagctgatggaatcctatggcgcgcattgcgtttatgtcaccgattccggtggg
cggttgacgatgggcagtgtccgggaccgggtgcgtgcgtatcgcgacgtgctcgatgcc
ggtacgcagatcggcattcacgcgcaccaaaatctgtcgttgtcggtggccaataccgtg
gtggccgttgaggaaggtgtcacccgggttgacgcctcgctggccggtcacggcgccggg
gcgggcaattgcccgatcgagccgttcatcgccgtggccgatctccatggctggaagcac
aactgtgatctcttcgggctgcaggacgccgccgacgacatcgtccgaccgctgcaggat
cggccggtccaagtcgaccgggagaccctcaccctgggatacgcaggcgtgtactcgagc
ttcctgcgtcatgccgaagccgccgcgaaacagtacggcctcgacactcgtgcgatcctg
ctcgcggtcggcgaacgcggactagtcggaggacaggaagacctcatccccgacatcgcg
ctcgatctacaacagaacttacgccgatag

DBGET integrated database retrieval system