KEGG   Methanococcus maripaludis X1: GYY_01510Help
Entry
GYY_01510         CDS       T01584                                 

Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00260  Glycine, serine and threonine metabolism
mmd01100  Metabolic pathways
mmd01110  Biosynthesis of secondary metabolites
mmd01120  Microbial metabolism in diverse environments
mmd01230  Biosynthesis of amino acids
Module
mmd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYY_01510
Enzymes [BR:mmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     GYY_01510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEK19189
UniProt: G0H2A9
Position
288914..289819
Genome map
AA seq 301 aa AA seqDB search
MKKVKVCSPGTSANLGPGYDIFGLALSNPYDIVEVEKTENGITISVEGEKAEEIPTNVDE
NTAGVVAKKMIQDFKIESGIHIHIIKGIKPGSGLGSSSASCAGIAFALNELFELKLSKLE
LVKYSSLGEAVAAGAPHADNVAPAIFGGFTLTTSYEPLEVLHIPIDLEVLVALPNIQVST
KTAREILPKEIPIKDMVNNVGKAAGMVYALYNNDLDLFGRYMSKDCVVEPCRANLIDGYA
EVKEKVKDMVYGITISGSGPAIITIPKKEHVIDIENIFKEVWNCPVYYTKVGPGCYVEEI
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaaaggtatgttctccgggaacttctgcaaatctcggtccaggatacgat
atttttgggcttgctctttcaaatccttatgatattgtagaggttgaaaaaacagaaaat
ggtatcactatatctgttgaaggggaaaaagcagaagaaatacctacaaacgtagatgaa
aatactgcaggcgtagttgctaaaaagatgattcaagattttaaaatcgaatctggaatt
catattcatataattaaaggaataaagccaggaagtggtcttggaagcagttctgcctca
tgtgcaggaattgcttttgcgttaaatgaactttttgaactaaaattatccaaattagag
ctagttaaatattcttcacttggggaagcagttgcagcaggtgctcctcacgcagataac
gtagctccagcaatttttggtggatttactcttacaacaagttatgaacctttagaggta
cttcatattccaatagatcttgaagttttggttgcacttccaaatattcaggtaagtaca
aaaaccgcaagagaaatacttccaaaagaaatcccgataaaagatatggtaaacaatgtt
ggaaaagctgcaggaatggtttatgcattatataacaacgatctagatctttttggaaga
tacatgtcaaaagactgcgttgttgagccatgcagggccaatttaattgatggatatgcg
gaagttaaagaaaaagtaaaagacatggtctatggtataacgattagtggttcaggacct
gcaattattacaatacctaaaaaagaacacgtaattgatatcgaaaatatatttaaggaa
gtctggaactgcccagtttactacacgaaagtggggcccggatgttacgttgaagaaatt
gaataa

DBGET integrated database retrieval system