KEGG   Methanococcus maripaludis X1: GYY_06350Help
Entry
GYY_06350         CDS       T01584                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00020  Citrate cycle (TCA cycle)
mmd00640  Propanoate metabolism
mmd00660  C5-Branched dibasic acid metabolism
mmd00720  Carbon fixation pathways in prokaryotes
mmd01100  Metabolic pathways
mmd01110  Biosynthesis of secondary metabolites
mmd01120  Microbial metabolism in diverse environments
mmd01130  Biosynthesis of antibiotics
mmd01200  Carbon metabolism
Module
mmd_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYY_06350
   00640 Propanoate metabolism
    GYY_06350
   00660 C5-Branched dibasic acid metabolism
    GYY_06350
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GYY_06350
Enzymes [BR:mmd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GYY_06350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 DUF5461 GARS_A HeH DUF5097
Motif
Other DBs
NCBI-ProteinID: AEK20133
UniProt: G0H0Q2
Position
1185042..1186130
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKEIFKENNIPIPKNKLVSGKVESIDYPVVIKAQVLVGGRGKAGGILFADNID
DANEKIESLIGNTVKGELVEKVLLEEQIKIAKEYYVGVVVNRNEKNNVVIFSTEGGVDIE
EVASKTPEKIIKLSLNPEKEFLPYLARGMLKKADIPSAEIPKVADVLCKVYKAFKNMDGI
LAEINPLIFTENGKIIAADAVLNVDDDAYFRHNYEKFEEFNKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEFGGNPACFLDVGGGSNRETVKKALLKATSRRNVKGAFINILGGI
TRCDEVSMGIVDVLKENPNLKFAVRMMGTNEEEGRRILSENGISFESSMEGAAKALTELI
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatatgaagcaaaggaaatttttaaagaaaataatatccctattcca
aaaaataaacttgtaagcggaaaggttgaaagtatcgattatcctgttgttataaaggcg
caagttttagttggtggaagaggtaaagctggcggaatcttatttgcagataatatcgat
gatgcaaacgaaaaaattgaatcattaattggaaacacggttaaaggcgaacttgttgaa
aaagtactcctcgaagagcagataaaaattgcaaaagaatattatgttggcgttgttgtt
aatagaaacgaaaaaaacaatgttgttatattttcaacagaaggtggagtagatatcgaa
gaagtagcttcgaaaactcctgaaaaaataataaaattatcattaaaccctgaaaaagaa
tttttaccataccttgcaagaggcatgcttaaaaaagcagatatcccaagtgcagaaatt
ccaaaagtagcagatgttttatgcaaagtttataaagcatttaaaaacatggatggaatt
ttagcggaaataaacccgctcatatttactgaaaatggaaaaatcattgctgctgatgca
gttttaaatgttgacgacgatgcatactttagacataactatgagaaatttgaagaattt
aataaacaggaaaaatccgaatttgcatatgttgaactggatggagacattgcagttatt
ggaaacggtgcaggactcacccttgcaagcatggacattgtaaaagaatttggcggaaat
cctgcatgtttcttagatgttggtggcggttcaaatagggaaaccgtaaaaaaagcactt
ttaaaagcaacctcccgaagaaacgttaaaggagcatttataaacattcttggcggaatt
acaaggtgtgatgaagtttcgatgggaattgtagatgttttaaaagaaaatccaaatctt
aagtttgctgtcaggatgatgggaacgaacgaagaagaaggaagaagaatattatctgaa
aatggaataagcttcgaaagctcgatggaaggggctgcaaaagcacttactgaattaata
aatagttaa

DBGET integrated database retrieval system