KEGG   Methanococcus maripaludis X1: GYY_07035Help
Entry
GYY_07035         CDS       T01584                                 

Definition
(GenBank) Sep-tRNA:Cys-tRNA synthetase
  KO
K06868  Sep-tRNA:Cys-tRNA synthetase [EC:2.5.1.73]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GYY_07035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmd03016]
    GYY_07035
Enzymes [BR:mmd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.73  O-phospho-L-seryl-tRNA:Cys-tRNA synthase
     GYY_07035
Transfer RNA biogenesis [BR:mmd03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    GYY_07035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SepSecS Aminotran_5 OKR_DC_1 Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEK20265
UniProt: G0H1I0
Position
1313033..1314175
Genome map
AA seq 380 aa AA seqDB search
MEINTDKYKNITRNLEREMINLNPIQRGGILPTESKKIIYEYWDGYSVCDYCSGRLDQIE
TPPINEFLEDMSKFLGMDITRPTHGARESKYAVMNSICKEGDYVVLDGNAHYTSYVALER
AKLNYEKTDIEEYPTFRVIPESYAEKIDMLEDSKKNIGLILLTHVDGNYGNVADVEKVGK
IAKSKGYPFLLNCAYSAGRMPIDGKKLNVDFIAASGHKSMAASGPCGLLSINKKYEDEVL
ETSKVNVLKELQMLGCTSRGIPILSLMASFEHLIERVKKWDLELEKTRKVVNELETLGFK
QIGERPRNHDIIRFETPILDEIAEKDKRRGFFFYEELKKRGIGGIRRGVTKEFKMSVYGL
TNTQVDYVINSMKSIINELR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggagataaatacggataaatacaaaaatattacgagaaatctcgaaagggaaatgatt
aacttaaatccaattcaaagaggagggatacttccaactgaatctaaaaaaataatctac
gaatactgggatgggtacagtgtctgtgattactgttcaggaagactcgaccaaatcgaa
actccccctataaacgaatttttagaagacatgtccaaatttttaggaatggacataaca
agacctacacacggtgcaagggaaagtaaatacgctgttatgaattccatctgtaaagaa
ggcgattacgtagtgttggatggaaatgcacactatacctcatacgtagcacttgaaaga
gcaaaattaaactatgaaaaaacggacattgaagaatacccgacatttagagtaattcct
gaaagttatgcagaaaaaattgacatgctcgaagattctaaaaaaaatattggattgatc
cttttaacacacgttgatggaaattacggaaacgttgcagatgttgaaaaggttggaaaa
attgcaaaatctaaaggatatccatttttattaaactgtgcatattctgctggaagaatg
ccaattgatggaaaaaaattaaacgtagactttattgcagcatcaggacacaaaagtatg
gctgcgtcaggcccatgcggtcttctttcaataaataaaaaatatgaagatgaagtgctt
gaaacttcaaaagtaaatgtattaaaagaactccagatgcttggttgcaccagtagagga
attccaattttaagtttgatggcaagctttgaacacctgattgaaagggttaaaaagtgg
gatttagaacttgaaaaaacaagaaaagtagttaacgagcttgaaacattaggatttaaa
cagattggggaaagaccaagaaaccacgatatcataagatttgaaaccccgattttagat
gaaattgcagaaaaagataaacgaagaggatttttcttctacgaagaattgaagaaaaga
ggaatcggcggaatcagaagaggagttacaaaagaattcaaaatgagtgtttatggatta
accaatactcaagttgactacgtgataaatagcatgaaatctattataaacgagttaagg
tga

DBGET integrated database retrieval system