KEGG   Methanococcus maripaludis X1: GYY_08360Help
Entry
GYY_08360         CDS       T01584                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit beta
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00010  Glycolysis / Gluconeogenesis
mmd00020  Citrate cycle (TCA cycle)
mmd00620  Pyruvate metabolism
mmd00633  Nitrotoluene degradation
mmd00640  Propanoate metabolism
mmd00650  Butanoate metabolism
mmd00680  Methane metabolism
mmd00720  Carbon fixation pathways in prokaryotes
mmd01100  Metabolic pathways
mmd01120  Microbial metabolism in diverse environments
mmd01130  Biosynthesis of antibiotics
mmd01200  Carbon metabolism
Module
mmd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mmd_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_08360
   00020 Citrate cycle (TCA cycle)
    GYY_08360
   00620 Pyruvate metabolism
    GYY_08360
   00640 Propanoate metabolism
    GYY_08360
   00650 Butanoate metabolism
    GYY_08360
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GYY_08360
   00680 Methane metabolism
    GYY_08360
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    GYY_08360
Enzymes [BR:mmd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GYY_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AEK20525
UniProt: G0H2X8
Position
complement(1547683..1548579)
Genome map
AA seq 298 aa AA seqDB search
MTGSQFPREELFAPGHRGCAGCGAAIVARLALKAAGKNTIVANATGCLEVMTTPYPETAW
KVPWIHVAFENAAAVASGVEGAVAALKRKRGKYGEEKVNVIAFGGDGGTADIGFQALSGA
MERGHDMVYIMYDNEAYMNTGVQRSGSTPLLASTTTSPAGSLIRGETMPKKNMPMIMAAH
GIPYVATASISYPEDFMKKVKKACEINGPAFIQVMQPCTTGWGYPADKTIELGRLAVETG
VWPLFEIENGEFKLNYKPLKRKPIEEYLKVQKRYRHLNPEEISVIQKTIDMKCDEYGL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactggaagccaatttccaagagaagaattatttgctccaggacacaggggctgtgca
ggttgtggtgcagcaattgttgcaagactcgctttaaaagctgctggaaaaaacacgatc
gttgcaaatgctacaggatgtcttgaagttatgacaacgccgtaccctgaaactgcatgg
aaagttccttggattcacgttgcattcgaaaacgctgctgcagtagcaagtggtgtcgaa
ggagctgtagctgctttaaagagaaaacgcggaaaatacggtgaagaaaaagtaaacgtt
attgcatttggtggtgacggcggtactgcagatatcggattccaagcactaagtggtgca
atggaaaggggccatgatatggtttatatcatgtatgataacgaagcttacatgaacacc
ggagttcaaagaagtggttcaacacctttattggcctcaacaacgacttcacctgccgga
agccttatccgtggggaaactatgcctaaaaagaacatgccaatgatcatggcagctcat
ggaataccttatgttgcaacagcgtcaataagctatccagaagacttcatgaaaaaagtt
aaaaaagcatgtgaaataaacggtcctgcatttattcaagtaatgcaaccatgtactacc
ggctggggatatcctgctgataaaacaattgaattgggcagacttgcagtagaaactggt
gtttggccacttttcgaaattgaaaatggtgaatttaagttaaactacaagccacttaaa
agaaaaccaattgaagaatacttaaaagtgcagaaaagatacagacacttaaatcccgaa
gagatttcagtaattcaaaagaccatcgacatgaaatgcgacgaatacggtctttaa

DBGET integrated database retrieval system