KEGG   Methanococcus maripaludis X1: GYY_08655Help
Entry
GYY_08655         CDS       T01584                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00680  Methane metabolism
mmd01100  Metabolic pathways
mmd01120  Microbial metabolism in diverse environments
mmd01200  Carbon metabolism
Module
mmd_M00357  Methanogenesis, acetate => methane
mmd_M00567  Methanogenesis, CO2 => methane
mmd_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmd00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    GYY_08655
Enzymes [BR:mmd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     GYY_08655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD
Motif
Other DBs
NCBI-ProteinID: AEK20584
UniProt: G0H3B5
Position
1601020..1601727
Genome map
AA seq 235 aa AA seqDB search
MDATSFILPLAEITIAGAIINASVHFVPVGGAPAAMATSTGVGTGTTQLAAGAGFTGLLA
AAAMASQAGVSLSNPVHMLLIMLSGAVGAMIMLGLTMLIGQIIYVYGIGIVPAADKCEKD
PITGDIQKPYITPGTTGHGIPTVCFVSGTIGAALGGLGGALAYIALQQLGFAAAIAGVLA
VGFFFMNAVLASYNIGGTIEGFHDPKFKKMPNGVIASFVSSLIAGAVLIGMAMGL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggatgctacaagctttatattacctcttgcggaaataaccattgcgggagcgattatc
aacgcaagtgttcacttcgttccagtaggtggtgctccagcagcgatggctacttcaaca
ggggtaggtacaggtacaacacagttagcagcaggtgcaggttttaccggactcttagct
gcagctgcaatggcttcgcaagcaggtgtttcactgtctaatccagttcacatgttatta
atcatgttatctggtgctgtcggtgcaatgatcatgttaggtcttacaatgttaattggt
cagattatctatgtatacggtattggtatcgtccctgcagcagataaatgtgaaaaagac
cctattacgggagatattcaaaaaccatacattacaccaggtacaacaggacacggtatt
ccaaccgtatgttttgtaagtggtacaattggtgcagctcttggtggtcttggtggtgct
cttgcatacatcgcactccagcagttaggatttgctgcagctattgcaggtgtattggca
gttggattcttcttcatgaacgcagtattagcttcatacaatattggtggtacaatcgaa
ggattccacgaccctaaatttaagaaaatgccaaacggagttattgcttcatttgtttct
tcattaatcgcaggagcagtattaattggaatggctatgggactttaa

DBGET integrated database retrieval system