KEGG   Marinomonas mediterranea: Marme_0018Help
Entry
Marme_0018        CDS       T01449                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mme  Marinomonas mediterranea
Pathway
mme00920  Sulfur metabolism
mme01100  Metabolic pathways
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Marme_0018
Enzymes [BR:mme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Marme_0018
Transfer RNA biogenesis [BR:mme03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Marme_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ADZ89324
UniProt: F2JUJ1
Position
20541..21404
Genome map
AA seq 287 aa AA seqDB search
MQDVGRHPIFKALQEIIHNAADAIMEIYQQEDLGIQQKSDDSPVTEADLAAHKVISEGLK
KLTPDIPILSEEDVKPFEERSKWRRLWVVDPLDGTKEFIKRNGEFSINIALVIDGESVLG
IVYLPTTSEGYFGATESLRKHDLWNDLPTGAMKWRGDDVEVIKVREPNSPFVAMTSRSHG
PALPEDFKQLLIEEYEHVRELPKGSSIKGCRIAEGIADLHLRRGPTCEWDTAAQQAVVEG
AGGVLITPKGDPFRYNQRDTLLNGHFIIANPQIAARVVNWYKQQENG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgttggtcgccacccaatttttaaagctctacaagaaataatacacaatgct
gctgatgctatcatggaaatttatcagcaagaggatttgggtattcaacaaaagtctgat
gacagtcctgtaacggaagcagatttagctgcacataaagtgatttctgaaggcttaaaa
aaattaacaccggatattccaattctatcagaagaagatgttaaaccgtttgaagaaaga
tccaaatggcgtcgactttgggttgtagatccgttagatggaacgaaagagtttattaag
cgcaatggagagttcagtatcaatatcgcgttggtgattgatggtgaatccgtgttgggc
attgtctatttgccaacaacgtctgaagggtattttggtgcgacggaatcactaagaaaa
cacgatctctggaacgaccttccaacgggcgcgatgaagtggcgcggcgacgatgtggaa
gtgataaaagtcagagaaccaaacagcccttttgtcgctatgacgagccgaagtcacggc
cccgcgttaccggaagactttaaacaactgttgattgaagaatacgagcatgtcagagag
ctgccaaaaggaagctctattaaaggatgtcgtattgctgaaggtattgctgatttgcac
cttcgtcgcggccctacatgtgaatgggatactgccgctcaacaagctgttgttgaaggt
gcgggcggtgtattgattacaccaaagggcgatccgttccgttataatcagcgcgacacg
ttattaaatggccatttcatcatagcgaatccacagatcgctgctcgagtggtgaattgg
tataagcagcaagaaaacggataa

DBGET integrated database retrieval system