KEGG   Marinomonas mediterranea: Marme_0433Help
Entry
Marme_0433        CDS       T01449                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mme  Marinomonas mediterranea
Pathway
mme00071  Fatty acid degradation
mme00072  Synthesis and degradation of ketone bodies
mme00280  Valine, leucine and isoleucine degradation
mme00310  Lysine degradation
mme00362  Benzoate degradation
mme00380  Tryptophan metabolism
mme00620  Pyruvate metabolism
mme00630  Glyoxylate and dicarboxylate metabolism
mme00640  Propanoate metabolism
mme00650  Butanoate metabolism
mme00900  Terpenoid backbone biosynthesis
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
mme01200  Carbon metabolism
mme01212  Fatty acid metabolism
mme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Marme_0433
   00630 Glyoxylate and dicarboxylate metabolism
    Marme_0433
   00640 Propanoate metabolism
    Marme_0433
   00650 Butanoate metabolism
    Marme_0433
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Marme_0433
   00072 Synthesis and degradation of ketone bodies
    Marme_0433
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Marme_0433
   00310 Lysine degradation
    Marme_0433
   00380 Tryptophan metabolism
    Marme_0433
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Marme_0433
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Marme_0433
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Marme_0433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mme04147]
    Marme_0433
Enzymes [BR:mme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Marme_0433
Exosome [BR:mme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Marme_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Terminase_6C DUF2268
Motif
Other DBs
NCBI-ProteinID: ADZ89732
UniProt: F2JZE9
Position
complement(451910..453085)
Genome map
AA seq 391 aa AA seqDB search
MKAVIVAAARSPIGAFNGALSTLSAVEIGTQVLSGLLNQTPALRAHIDEVILGQVLSAGC
GQNPARQTALHAGLAQSVSAMTINKVCGSGLKAVQLAAQSILNGDAKMVVAGGQESMSQA
AHVLPKSRNGKKMGDWTLLDSMVTDGLWDAFNDYHMGQTAENIASKWNITREEQDRFAAK
SQQKAAAAQAAGRFIDEILPISIPQRKGEPLNITEDEQIRPDSNEASLGKLRAAFSKDGT
VTAGNASTLNDGAAMVVVTSDEEAQRLELPILATIEASASVGVAPEIMGTGPIASSNKAL
QKAQWNINDLDLIEANEAFAVQAMCVNQELGLDQDKVNVNGGAIALGHPIGASGCRILVS
LLHEMRKRDAQKGLATLCVGGGMGVSLLVSR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttatcgtcgctgcggcacgctcccccattggcgcgtttaacggcgcgcta
tcaaccctaagcgccgtcgagattggaacacaagtactgtcggggctactaaaccaaact
ccagcccttagagcacatattgatgaggtgattctcggtcaagtgctcagtgctggctgt
ggacaaaacccagctcgccaaacagcgttacacgcaggattagctcaatccgtttccgca
atgaccatcaataaggtctgtggctcaggcctaaaagccgtccagctcgccgcccagtca
atactcaacggcgacgcaaaaatggtggtcgctggaggacaagaaagcatgagtcaggcg
gcacatgttctaccgaaaagccgcaatggtaaaaagatgggggattggacgctattagac
tccatggtcaccgacggcctgtgggatgcgtttaacgattatcacatgggacaaaccgct
gaaaacatcgcatcgaagtggaacattacgcgtgaggaacaagaccgctttgccgctaag
tctcaacaaaaagccgctgccgcacaagccgcagggcgttttattgatgagatccttcct
atttcgattcctcaacgcaaaggagagccgctaaacatcacggaagacgagcaaattcgt
ccagattccaatgaagcgtctcttggaaaactgcgtgcggccttttcaaaagacggaacc
gtgaccgcaggcaacgcctccactctaaatgacggtgccgcaatggtggtcgttacttcc
gacgaagaagctcaacgattagagctccctatactcgcaacgatagaagcttctgcaagc
gtgggcgtagcgccagaaattatgggcactggccccattgcatcaagcaacaaagcattg
caaaaagcccaatggaacatcaatgatctagacttaatcgaagcaaacgaagcatttgcg
gttcaagcgatgtgcgttaaccaagagctagggttggatcaagacaaagtcaacgtaaac
ggtggtgccattgcattaggccatcctattggtgcgtctggctgtcgaattctcgtttca
ttgctgcatgaaatgcgtaaaagagacgctcaaaaaggtctcgctaccttgtgtgtcggc
ggtggtatgggagtctcgttactcgtatcgcgttaa

DBGET integrated database retrieval system