KEGG   Marinomonas mediterranea: Marme_0773
Entry
Marme_0773        CDS       T01449                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
mme  Marinomonas mediterranea
Brite
KEGG Orthology (KO) [BR:mme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mme02044]
    Marme_0773
Secretion system [BR:mme02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Marme_0773
SSDB
Motif
Pfam: T6SS_VipA FTA4
Other DBs
NCBI-ProteinID: ADZ90056
UniProt: F2K2L1
Position
832109..832606
AA seq 165 aa
MALNSQHKRVSKNRVSITYDVETNGAVENKELPFVMGVIGDFSAHKEDREELEDRTFYQI
DKDNFDTVLNRVGPELKLKVDNTLSDDGSQFEAALSFSSMKDFEPDSLIEQVDPLKKLAE
TRQQLKTLLSKADRSRDLEKLLKEVLQSADQINALSSELGIEKGE
NT seq 498 nt   +upstreamnt  +downstreamnt
atggccttaaattcgcagcataagcgtgtcagtaaaaaccgcgtaagtattacttacgat
gtagaaacaaatggcgcagttgaaaacaaagaactgccatttgttatgggtgtgataggg
gatttttctgcacacaaagaagatcgtgaagagttggaggatcgcaccttctaccagatc
gataaagacaactttgatacagtccttaaccgagtgggaccagaattaaagttaaaagtt
gataacactttgtctgatgatggcagccaatttgaggcagcgttgtctttctcttctatg
aaagatttcgaaccagattctttgatcgaacaagtagaccctctgaagaaattagcagag
acccgtcagcagttaaaaacgctactttctaaagcagaccgctcacgcgatcttgagaag
cttttaaaagaagtgctacaaagcgcggatcaaatcaacgcattgtctagcgagcttggc
atcgagaaaggagaataa

DBGET integrated database retrieval system